Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 63 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27180 56 / 2e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G12020 53 / 2e-08 WRKY MEKK4, MAPKKK11, ATWRKY19, WRKY19 MAPK/ERK KINASE KINASE 4, MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 11, protein kinase family protein (.1.2.3) AT5G45050 53 / 2e-08 WRKY ATWRKY16, TTR1 TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G27170 53 / 2e-08 transmembrane receptors;ATP binding (.1.2) AT5G45210 52 / 4e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 49 / 4e-07 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G45260 47 / 2e-06 WRKY ATWRKY52, SLH1, RRS1 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT4G36140 47 / 3e-06 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G49140 46 / 4e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G004599 [exp] 99 / 3e-24 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.012G135700 [exp] 89 / 6e-21 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G037599 [exp] 87 / 6e-20 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001602 [exp] 80 / 1e-17 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001600 [exp] 76 / 5e-16 AT5G36930 721 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G142600 [exp] 73 / 3e-15 AT5G36930 535 / 5e-173 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 72 / 1e-14 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 71 / 2e-14 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 71 / 2e-14 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039850 [exp] 75 / 1e-15 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029722 [exp] 72 / 8e-15 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018616 [exp] 71 / 1e-14 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 71 / 2e-14 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005171 [exp] 69 / 7e-14 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10033825 [exp] 69 / 1e-13 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007809 [exp] 61 / 6e-11 AT5G36930 239 / 5e-65 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007810 [exp] 61 / 8e-11 AT5G36930 242 / 1e-65 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10035674 [exp] 61 / 9e-11 AT5G36930 410 / 1e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10003749 [exp] 58 / 7e-10 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G231200.2 pacid=42799761 polypeptide=Potri.010G231200.2.p locus=Potri.010G231200 ID=Potri.010G231200.2.v4.1 annot-version=v4.1 ATGATAAAGCAAAAGCTATATCATGCTTTTTCTTTGATTCAGACAGAATATATAATCGAGATACTATATGGCCTTGGTTTCTTTTCAGAAATTGATATTA ATTTTCTCGTTGATAGTTCTCTTTTAACTATTAACAACTCAAATCAATTAGAGATGCATGGTCTGTTGCGAGACATGGGAAGAGAGGTTGTTTGTGAATT GTCACCTAACCATCCTGGAAAACATGGTAGAATTTGGCTTCCTAAGGATGTGCAGGGTGTGCTCAACAATCAGACGGTAAGAATTAAATCCGTATGCCTA GTCCGGTCTTGCACACAAACAATTTTCTGTCTCTTATATCAACTTTTTAGAGAGTTCACCAATTTTTTTTCTGGATGGATCATCTTCCACACCATTATAG GTGATACTTCTGCTATTTTGAACTGTTTTCAGTTAACTGAAGTTGTGGCGGGTCTCGCACTAGATGTGCATTTTACATCAAAAAGTCTACCTCTAAGCAG GATGAGATATTTAAATTTACTTCTAATTGATGAAGTAAATCTCACTGGACGATAA
AA sequence Show only first row Show all	>Potri.010G231200.2 pacid=42799761 polypeptide=Potri.010G231200.2.p locus=Potri.010G231200 ID=Potri.010G231200.2.v4.1 annot-version=v4.1 MIKQKLYHAFSLIQTEYIIEILYGLGFFSEIDINFLVDSSLLTINNSNQLEMHGLLRDMGREVVCELSPNHPGKHGRIWLPKDVQGVLNNQTVRIKSVCL VRSCTQTIFCLLYQLFREFTNFFSGWIIFHTIIGDTSAILNCFQLTEVVAGLALDVHFTSKSLPLSRMRYLNLLLIDEVNLTGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.010G231200 [exp]	0	1
AT5G47900			Protein of unknown function (D...		Potri.014G123800 [exp]	2.44	0.7428
AT1G02860		BAH1, NLA	nitrogen limitation adaptation...		Potri.002G205400 [exp]	3.00	0.8080
AT1G29750		RKF1	receptor-like kinase in flower...		Potri.004G063500 [exp]	6.92	0.7590	RKF1.1
AT5G51920			Pyridoxal phosphate (PLP)-depe...		Potri.015G137900 [exp]	8.66	0.6913
AT2G30000			PHF5-like protein (.1)		Potri.001G277800 [exp]	10.19	0.7299
AT5G61910			DCD (Development and Cell Deat...		Potri.012G108200 [exp]	13.03	0.7097	Pt-BON1.3
AT3G14250			RING/U-box superfamily protein...		Potri.001G037200 [exp]	13.26	0.7167
AT1G11950			Transcription factor jumonji (...		Potri.004G006200 [exp]	14.14	0.6989
AT3G18670			Ankyrin repeat family protein ...		Potri.006G281600 [exp]	14.96	0.7304
AT4G33300		ADR1-L1	ADR1-like 1 (.1.2)		Potri.002G129300 [exp]	15.19	0.6987	ADR1.1

Compare expression of checked genes

Potri.010G231200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.