Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04470 39 / 9e-05 SIM SIAMESE, cyclin-dependent protein kinase inhibitors (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G029600 [exp] 66 / 4e-15 AT5G02420 48 / 5e-08 unknown protein Potri.010G231600 [exp] 56 / 4e-11 AT5G02420 44 / 1e-06 unknown protein Potri.009G003400 [exp] 43 / 2e-06 AT5G02420 45 / 7e-07 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037925 [exp] 49 / 2e-08 AT5G02420 47 / 2e-07 unknown protein Lus10038653 [exp] 45 / 6e-07 AT5G02420 47 / 2e-07 unknown protein Lus10017454 [exp] 38 / 0.0003 ND 38 / 3e-04
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G231700.1 pacid=42798917 polypeptide=Potri.010G231700.1.p locus=Potri.010G231700 ID=Potri.010G231700.1.v4.1 annot-version=v4.1 ATGTCTAGCGATCAGGAACTCTTCCAAAACTTGCCAAAACTTGGATTGAAAGTGATAAAGACGACTCGTAATGATGATGGTGAAGATGATGACTGTGAGC AATATGAGTGCTGCACTCCAACATCAGCTCAACACAAGATTCCCGCCTTGTTAACCTGTCCACCAGCACCAAAGAAACCACCAAGAAGTCCAGATTCATG CAAGAGGAAACTGTCAAATCTGCACTTTTTTGAGGTTATGAACCGTGAAGAGGTGGACTTGTTTTTTAGGTCAAGCAAGAAGGTTGGTTTCGCCTCTGGG GTGGTCGCCTAA
AA sequence Show only first row Show all	>Potri.010G231700.1 pacid=42798917 polypeptide=Potri.010G231700.1.p locus=Potri.010G231700 ID=Potri.010G231700.1.v4.1 annot-version=v4.1 MSSDQELFQNLPKLGLKVIKTTRNDDGEDDDCEQYECCTPTSAQHKIPALLTCPPAPKKPPRSPDSCKRKLSNLHFFEVMNREEVDLFFRSSKKVGFASG VVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04470		SIM	SIAMESE, cyclin-dependent prot...		Potri.010G231700 [exp]	0	1
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Potri.004G018800 [exp]	1.73	0.9724	Pt-CYP77.2
AT3G06470			GNS1/SUR4 membrane protein fam...		Potri.003G019800 [exp]	2.44	0.9701
AT2G45260			Plant protein of unknown funct...		Potri.013G155400 [exp]	7.14	0.9609
AT3G50390			Transducin/WD40 repeat-like su...		Potri.006G239600 [exp]	12.24	0.9499
AT5G54740		SESA5	seed storage albumin 5 (.1)		Potri.011G134600 [exp]	13.49	0.8696	Pt-AT2.1
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.002G060900 [exp]	14.14	0.9502
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Potri.001G177900 [exp]	14.31	0.8577
AT5G51800	Trihelix		Protein kinase superfamily pro...		Potri.012G132300 [exp]	14.79	0.8489
AT2G29125		RTFL2, DVL13	DEVIL 13, ROTUNDIFOLIA like 2 ...		Potri.001G242800 [exp]	15.81	0.9467
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128100 [exp]	16.24	0.9446

Compare expression of checked genes

Potri.010G231700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.