Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04600 260 / 1e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G07810 57 / 1e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G47120 53 / 3e-08 C3HZnF RNA recognition motif (RRM)-containing protein (.1) AT2G33410 51 / 2e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G26650 50 / 2e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G55550 50 / 4e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) AT5G47620 50 / 5e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) AT1G55310 48 / 1e-06 ATSCL33, SR33, At-SCL33 SC35-like splicing factor 33 (.1.2.3) AT5G40490 48 / 2e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G13570 47 / 2e-06 SCL30A, At-SCL30A SC35-like splicing factor 30A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G222400 [exp] 54 / 2e-08 AT3G07810 439 / 8e-151 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.014G161600 [exp] 53 / 4e-08 AT3G07810 498 / 3e-174 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.010G067500 [exp] 51 / 2e-07 AT4G14300 302 / 7e-99 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G361300 [exp] 51 / 2e-07 AT3G07810 433 / 1e-148 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.008G170400 [exp] 50 / 4e-07 AT4G14300 317 / 2e-104 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.016G010200 [exp] 50 / 5e-07 AT3G07810 413 / 2e-140 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.002G258600 [exp] 50 / 5e-07 AT4G14300 277 / 1e-89 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G044900 [exp] 49 / 6e-07 AT3G47120 276 / 8e-91 RNA recognition motif (RRM)-containing protein (.1) Potri.006G015700 [exp] 49 / 8e-07 AT3G07810 447 / 8e-154 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018666 [exp] 261 / 8e-89 AT5G04600 239 / 6e-80 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10007730 [exp] 258 / 1e-87 AT5G04600 243 / 6e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10017555 [exp] 52 / 1e-07 AT3G07810 423 / 7e-144 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10035556 [exp] 51 / 2e-07 AT2G36670 623 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Lus10000537 [exp] 50 / 4e-07 AT3G07810 420 / 8e-143 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043168 [exp] 50 / 4e-07 AT3G07810 456 / 2e-157 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10032579 [exp] 50 / 5e-07 AT3G07810 447 / 8e-154 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10038806 [exp] 50 / 7e-07 AT3G07810 417 / 2e-141 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043124 [exp] 50 / 7e-07 AT2G33410 334 / 2e-111 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10024937 [exp] 49 / 7e-07 AT4G14300 306 / 4e-101 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.010G234800.1 pacid=42799961 polypeptide=Potri.010G234800.1.p locus=Potri.010G234800 ID=Potri.010G234800.1.v4.1 annot-version=v4.1 ATGGGGGCGAAAGCAAAGAAATCACTGAAAAAGAAAATGAGCAAAATTTCTTCTTCTACGTCAACCCAGTTAGTTAATGGAAAACAAGCCGCTGCTGATT TCTTGCCATTAGAAGGTGGACCGGCGCGGAAGTTACCGGAATTGAAAGAGCTGAAAAAGAAGTCCGGTGTGCTGTATATTGGTAGGATACCTCATGGTTT CTACGAGGAAGAAATGAAAGCTTATTTTTCGCAATTCGGTACTATCAAGAGATTGAGAATTGCGAGGAATAAAAAGACTGGAAAATCAAAGCATTTTGGA TTCATGGAATTTGAAGATCCTGAGGTGGCAGAAGTTGTAGCTGAATGTATGCATAACTATCTGTTGTTTGAGCATCTTTTGCAAGTCTATGTTATTCCAC AGGAGCATGTTCATCCTAAATTATGGAAAGGTTTTAATTATCGTTTCAACCCTGTGGACCGGCTTCAAACCGAAAGAAAACGACAGAACAAGGAGAGAAC ACTTGATGAGCACAGAAGATTGGTGGGCAGGATTATGAAGCGAGATCAGAAGCGACGAAAAAAGATAGAAGCTGCTGGTTTGGATTATGAGTGCCCGGAA TTTGTTGGTGATGTCAAGTGTGTGCCAAAGAAGATTAAGTTCAGCCAAGATTAG
AA sequence Show only first row Show all	>Potri.010G234800.1 pacid=42799961 polypeptide=Potri.010G234800.1.p locus=Potri.010G234800 ID=Potri.010G234800.1.v4.1 annot-version=v4.1 MGAKAKKSLKKKMSKISSSTSTQLVNGKQAAADFLPLEGGPARKLPELKELKKKSGVLYIGRIPHGFYEEEMKAYFSQFGTIKRLRIARNKKTGKSKHFG FMEFEDPEVAEVVAECMHNYLLFEHLLQVYVIPQEHVHPKLWKGFNYRFNPVDRLQTERKRQNKERTLDEHRRLVGRIMKRDQKRRKKIEAAGLDYECPE FVGDVKCVPKKIKFSQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04600			RNA-binding (RRM/RBD/RNP motif...		Potri.010G234800 [exp]	0	1
AT2G33340		MAC3B	MOS4-associated complex 3B (....		Potri.008G171600 [exp]	4.24	0.7481
AT3G13882			Ribosomal protein L34 (.1.2)		Potri.003G041100 [exp]	10.09	0.7219
AT4G26300		EMB1027	embryo defective 1027, Arginyl...		Potri.002G198500 [exp]	13.11	0.7089
AT3G07870			F-box and associated interacti...		Potri.011G137200 [exp]	15.00	0.7058
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Potri.009G027000 [exp]	15.87	0.7057
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.017G059000 [exp]	17.23	0.7126
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Potri.016G093944 [exp]	19.89	0.6688
AT5G10980			Histone superfamily protein (....		Potri.002G100200 [exp]	27.27	0.6411
AT1G23280			MAK16 protein-related (.1)		Potri.015G083700 [exp]	33.36	0.6546
AT5G13780			Acyl-CoA N-acyltransferases (N...		Potri.001G261800 [exp]	34.24	0.6592

Compare expression of checked genes

Potri.010G234800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.