Potri.010G234900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G025700 102 / 4e-28 AT4G40045 84 / 4e-21 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034155 47 / 3e-07 AT4G40045 99 / 4e-27 unknown protein
Lus10043427 47 / 5e-07 AT4G40045 99 / 4e-27 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G234900.1 pacid=42799121 polypeptide=Potri.010G234900.1.p locus=Potri.010G234900 ID=Potri.010G234900.1.v4.1 annot-version=v4.1
ATGTTAGGGCTTGATTTTTCCTTGCACCCACAAATCCCTTCATTTTCAAGAACCCCTCTTCTCCATCCCCAACCCACTCTCCCTCCCGCTTCTTTCCCTC
TCAAAATCTCCAAGAAAACCCATCCAAGACTCGTTTTTGCACGAACCAACAACAATAACGACCCAGCTCAAGAACCCAAAGAACCAGAACAAGAAAAGAA
AAATGGGTCTTCCAATAACAGTGGCGGTGGTTATGATTTGAAGCAAGATCAGCCACCTCCCTTATTCGATATCAAGTGGGGTGATTTGTTACTGAACCCA
GATCCCGATAATATCTTGGCCGTTGGATTAACTGGTTTGTTGTCCTGGGCTAGTGTTCAAGTTCTTTGGCAGCTTTTCGTTATCGCTTTGGCTATTCTTG
TTGCTGCTGTTAAGTACTCTTTCATTGCTGCTCTCCTTATTTTCATCCTCATTACTCTTCTTTGA
AA sequence
>Potri.010G234900.1 pacid=42799121 polypeptide=Potri.010G234900.1.p locus=Potri.010G234900 ID=Potri.010G234900.1.v4.1 annot-version=v4.1
MLGLDFSLHPQIPSFSRTPLLHPQPTLPPASFPLKISKKTHPRLVFARTNNNNDPAQEPKEPEQEKKNGSSNNSGGGYDLKQDQPPPLFDIKWGDLLLNP
DPDNILAVGLTGLLSWASVQVLWQLFVIALAILVAAVKYSFIAALLIFILITLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G40045 unknown protein Potri.010G234900 0 1
AT3G24030 hydroxyethylthiazole kinase fa... Potri.003G174400 5.47 0.9192
AT1G22160 Protein of unknown function (D... Potri.005G168900 6.63 0.8920
AT5G39410 Saccharopine dehydrogenase (.... Potri.004G126100 7.07 0.8919
AT4G14910 HISN5B, IGPD HISTIDINE BIOSYNTHESIS 5B (.1.... Potri.010G087600 16.37 0.8948
AT5G06130 chaperone protein dnaJ-related... Potri.006G210500 26.72 0.8606
Potri.006G028500 33.10 0.8734
Potri.019G045600 36.46 0.8749
AT4G25370 Double Clp-N motif protein (.1... Potri.015G131700 37.54 0.8853
AT5G23070 Thymidine kinase (.1) Potri.006G015800 43.04 0.8584
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.015G118900 54.38 0.8474

Potri.010G234900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.