Potri.010G235200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20823 79 / 5e-18 RING/U-box superfamily protein (.1)
AT3G16720 81 / 9e-18 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT4G10160 78 / 2e-17 RING/U-box superfamily protein (.1)
AT4G10150 78 / 2e-17 RING/U-box superfamily protein (.1)
AT1G76410 77 / 2e-17 ATL8 RING/U-box superfamily protein (.1)
AT4G28890 80 / 3e-17 RING/U-box superfamily protein (.1)
AT3G14320 77 / 5e-17 Zinc finger, C3HC4 type (RING finger) family protein (.1)
AT4G09120 78 / 7e-17 RING/U-box superfamily protein (.1)
AT2G20030 78 / 9e-17 RING/U-box superfamily protein (.1)
AT1G49220 76 / 2e-16 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G025300 356 / 4e-126 AT4G40070 86 / 7e-20 RING/U-box superfamily protein (.1)
Potri.014G076800 159 / 5e-49 AT4G10150 84 / 1e-19 RING/U-box superfamily protein (.1)
Potri.002G153400 149 / 7e-45 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1)
Potri.008G018900 79 / 3e-18 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1)
Potri.011G063100 78 / 2e-17 AT2G42350 106 / 3e-28 RING/U-box superfamily protein (.1)
Potri.007G111900 80 / 3e-17 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1)
Potri.018G085001 80 / 3e-17 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1)
Potri.006G201500 76 / 3e-17 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Potri.016G067900 76 / 3e-17 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043426 282 / 7e-97 AT4G40070 84 / 5e-19 RING/U-box superfamily protein (.1)
Lus10034157 277 / 4e-95 AT4G40070 84 / 7e-19 RING/U-box superfamily protein (.1)
Lus10015167 82 / 2e-18 AT3G05200 226 / 2e-71 RING/U-box superfamily protein (.1)
Lus10020859 81 / 5e-18 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
Lus10031515 81 / 8e-18 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
Lus10033515 79 / 1e-17 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
Lus10014526 80 / 2e-17 AT5G40250 423 / 6e-148 RING/U-box superfamily protein (.1)
Lus10032161 80 / 2e-17 AT5G40250 413 / 7e-144 RING/U-box superfamily protein (.1)
Lus10002194 79 / 2e-17 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1)
Lus10034953 79 / 4e-17 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.010G235200.1 pacid=42799514 polypeptide=Potri.010G235200.1.p locus=Potri.010G235200 ID=Potri.010G235200.1.v4.1 annot-version=v4.1
ATGATGGCTTCAGGGATAAATTTGGTAATGACAGTGATTGGATTTTCTGTAAGCACTATGTTTATAGTTTTTGTTTGCACTCGTCTTATTTGTGCTCGGA
TTCAGTTAAATGCATCAAGACGATCTTTTCGTATTGCTTCCAGATCTGATCTTAGCATGTTGGAACGAGGTTTACATGGTCTTGAGCCTGTAGTTATAGC
TAGCTTTCCAACCAAGAAGTACAACGATAAGCTTTTCTCGGCTTCAGAAGATGCTCAGTGCACAGTTTGCCTTGCAGAATACCATGGCAAAGATATATTG
CGTATTCTCCCCTACTGTGGGCACTCCTTCCACGTGACCTGCATAGACATGTGGTTGCAACAGCATTCTACTTGTCCCATGTGTCGAATATCATTGCGTG
AATTTCCCGAGAAGAAGTGCGCGATGCAACCCTTGTTCAGTTCAGCTATCCGTTCTCAATATGGCACAGAGACCTTTGATTCCCATTCTTATAACTATTT
GTTGACTGGGCATGGGATTTCACAAAGATCAGACGACAGCCATGGGATGGACACCATTCAAGATAATCTTTGTGCATCTGATGGTGATGAAGCATGTGGG
GAGAATTCACCCCCCTTAACCGAGAGTAATCAGATTGCAAAAGACACAGGAGACAAGCATGTAGAAAGCCCGTCAAATCCCTAA
AA sequence
>Potri.010G235200.1 pacid=42799514 polypeptide=Potri.010G235200.1.p locus=Potri.010G235200 ID=Potri.010G235200.1.v4.1 annot-version=v4.1
MMASGINLVMTVIGFSVSTMFIVFVCTRLICARIQLNASRRSFRIASRSDLSMLERGLHGLEPVVIASFPTKKYNDKLFSASEDAQCTVCLAEYHGKDIL
RILPYCGHSFHVTCIDMWLQQHSTCPMCRISLREFPEKKCAMQPLFSSAIRSQYGTETFDSHSYNYLLTGHGISQRSDDSHGMDTIQDNLCASDGDEACG
ENSPPLTESNQIAKDTGDKHVESPSNP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20823 RING/U-box superfamily protein... Potri.010G235200 0 1
AT4G24015 RING/U-box superfamily protein... Potri.001G088400 4.24 0.6504
AT3G07340 bHLH bHLH062 basic helix-loop-helix (bHLH) ... Potri.014G148900 5.19 0.6741
AT4G18820 AAA-type ATPase family protein... Potri.011G071300 6.24 0.7038
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Potri.009G128300 13.03 0.6119
AT4G14770 CPP ATTCX2 TESMIN/TSO1-like CXC 2 (.1) Potri.008G156100 13.74 0.6313 TSO1.2
AT4G22730 Leucine-rich repeat protein ki... Potri.003G115100 18.38 0.6891
AT3G05900 neurofilament protein-related ... Potri.013G001150 27.56 0.6375
AT3G44716 unknown protein Potri.009G148200 27.83 0.6509
AT2G01820 CYCJ18 Leucine-rich repeat protein ki... Potri.010G103000 36.05 0.6244
AT5G58320 Kinase interacting (KIP1-like)... Potri.019G061600 43.39 0.6502

Potri.010G235200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.