Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66950 236 / 3e-71 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT2G36380 224 / 3e-67 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) AT2G26910 169 / 4e-48 PEC1, ABCG32, PDR4, ATPDR4 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) AT2G29940 169 / 8e-48 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) AT1G15520 164 / 2e-46 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT3G16340 152 / 4e-42 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT1G15210 148 / 1e-40 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT3G53480 143 / 5e-39 PIS1, ABCG37, PDR9, ATPDR9 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) AT1G59870 142 / 1e-38 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT2G37280 135 / 3e-36 ABCG33, PDR5, ATPDR5 ATP-binding cassette G33, pleiotropic drug resistance 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G024400 [exp] 355 / 6e-114 AT1G66950 2011 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Potri.006G115000 [exp] 262 / 2e-80 AT1G66950 2148 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Potri.009G147100 [exp] 202 / 1e-59 AT2G36380 1759 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) Potri.018G032900 [exp] 178 / 4e-51 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G057301 [exp] 168 / 2e-50 AT1G15520 382 / 1e-121 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G183200 [exp] 174 / 6e-50 AT1G15520 2031 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.006G248500 [exp] 173 / 2e-49 AT1G15520 2050 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048900 [exp] 172 / 4e-49 AT1G15520 2055 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048700 [exp] 171 / 1e-48 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008984 [exp] 254 / 2e-77 AT2G36380 2007 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) Lus10028841 [exp] 228 / 2e-68 AT1G66950 1374 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10014384 [exp] 223 / 1e-66 AT1G66950 1917 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10027725 [exp] 211 / 1e-62 AT1G66950 1077 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10006277 [exp] 196 / 2e-57 AT1G66950 1791 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10020568 [exp] 196 / 3e-57 AT1G66950 1761 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10023879 [exp] 191 / 8e-56 AT2G36380 1369 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) Lus10019453 [exp] 179 / 3e-51 AT2G26910 2354 / 0.0 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) Lus10041668 [exp] 168 / 1e-47 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041685 [exp] 167 / 2e-47 AT1G15520 1271 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08370 [poplar] [flax] PDR_assoc Plant PDR ABC transporter associated
Representative CDS sequence Show only first row Show all	>Potri.010G235801.1 pacid=42798009 polypeptide=Potri.010G235801.1.p locus=Potri.010G235801 ID=Potri.010G235801.1.v4.1 annot-version=v4.1 ATGACATACATGAAAAAAAAATTACACCATTTTGCAGATAATATTGGACCCTGGATGATCTGGGGCTACCATATTTCTCCCATGATGCATGGACAGAAAG CCATAGTCCTCAAAGAGTTTCTCGACGAAAGATGGAGTGTGCCAAATCATGACAAAGCATTTTCTGAGCCCACTGTTGGAAAGGTTCTTCTGAAAATGAG AGGCATGTTCATGGAAGGATATTGGTATTGGATTTCGATTGGGGTACTTCGAGGATTTGCTCTGGTTTTTAATGTCCTTTTTGTAGCCGCACTGACTTAT TTGGATCCTCTGGGAGAATCTAAATCCATTATTCTGGAAGAGGATGAGACTACGAAGTCATCCTCAACTGGAAAGCAAGCAGCAAAGGCCTTAGAAATGA CTCCAGCATCTGCTGCCCAATTCTCTGAAGTTGCAGAGCAAGCGCCTAAGCAACGAGGAATGGTGTTGCCCTTCCAGCCCTTGTCACTTGCATTTAATCA TGTGAATTACTATGTTGATGTGCCTATGGAAATGAAAATGCAAGGAATTGAAGAGGATAGCCTCCAGCTGTTACGTGATGTTAGTGGTGTTTTCAGGCCC GGTGTTCTAACAGCATTGGTTGGTGTAACTTGTAAGTGGTGCTGGAAAGACAACTTTGATGGATGTTCTTGCTGGTCGGAAAACTGGAGGGTACATTGA
AA sequence Show only first row Show all	>Potri.010G235801.1 pacid=42798009 polypeptide=Potri.010G235801.1.p locus=Potri.010G235801 ID=Potri.010G235801.1.v4.1 annot-version=v4.1 MTYMKKKLHHFADNIGPWMIWGYHISPMMHGQKAIVLKEFLDERWSVPNHDKAFSEPTVGKVLLKMRGMFMEGYWYWISIGVLRGFALVFNVLFVAALTY LDPLGESKSIILEEDETTKSSSTGKQAAKALEMTPASAAQFSEVAEQAPKQRGMVLPFQPLSLAFNHVNYYVDVPMEMKMQGIEEDSLQLLRDVSGVFRP GVLTALVGVTCKWCWKDNFDGCSCWSENWRVH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.010G235801 [exp]	0	1
AT3G26020			Protein phosphatase 2A regulat...		Potri.008G180000 [exp]	3.87	0.8727
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Potri.002G180100 [exp]	4.47	0.8693	PtrMTP2,Pt-MTP1.2
AT2G18220			Noc2p family (.1)		Potri.003G213450 [exp]	5.83	0.8858
AT3G50930		BCS1	cytochrome BC1 synthesis (.1)		Potri.010G057900 [exp]	6.32	0.8471
AT1G69770		CMT3	chromomethylase 3 (.1)		Potri.003G215800 [exp]	6.63	0.8435	CMT3.2
AT3G13080		EST2, ATMRP3, A...	MULTIDRUG RESISTANCE PROTEIN 3...		Potri.008G179500 [exp]	6.92	0.8509
AT1G11330			S-locus lectin protein kinase ...		Potri.011G039000 [exp]	7.34	0.8499
AT4G27680			P-loop containing nucleoside t...		Potri.012G025351 [exp]	11.48	0.8545
AT1G17070			GC-rich sequence DNA-binding f...		Potri.019G043200 [exp]	13.78	0.8654
AT1G03610			Protein of unknown function (D...		Potri.017G152601 [exp]	14.69	0.8433

Compare expression of checked genes

Potri.010G235801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.