Potri.010G237600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52770 50 / 5e-10 ZPR3 LITTLE ZIPPER 3, protein binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G021766 74 / 1e-19 AT3G52770 51 / 1e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.006G083201 56 / 2e-11 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.003G117200 36 / 0.0003 AT3G60890 63 / 4e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.002G149600 35 / 0.0009 AT3G60890 65 / 1e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.014G071200 35 / 0.0009 AT3G60890 62 / 1e-13 LITTLE ZIPPER 2, protein binding (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021375 56 / 6e-12 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10017055 54 / 2e-11 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10022725 54 / 2e-11 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1)
Lus10014188 52 / 6e-11 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence
>Potri.010G237600.2 pacid=42798292 polypeptide=Potri.010G237600.2.p locus=Potri.010G237600 ID=Potri.010G237600.2.v4.1 annot-version=v4.1
ATGGAAAAGCTAAACTCGCAGCTATACTTGCAGAACTGTTATATAATCCAACAGAATGAGATGCTAAGGAAGAAAGCTCAGCGGCTAAACCAAGAGAATC
AGGCACTGTTGTCAGAGCTGAAGCAGAAACTCTCCAAGGCAAGCTCCAGTTCTACAACAAATCCCGTTAATTCTGACAAGCCCTGA
AA sequence
>Potri.010G237600.2 pacid=42798292 polypeptide=Potri.010G237600.2.p locus=Potri.010G237600 ID=Potri.010G237600.2.v4.1 annot-version=v4.1
MEKLNSQLYLQNCYIIQQNEMLRKKAQRLNQENQALLSELKQKLSKASSSSTTNPVNSDKP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G52770 ZPR3 LITTLE ZIPPER 3, protein bindi... Potri.010G237600 0 1
AT3G18050 unknown protein Potri.012G049000 5.00 0.8644
AT3G21870 CYCP2;1 cyclin p2;1 (.1) Potri.007G121500 136.42 0.8508
AT1G24470 ATKCR2, KCR2 beta-ketoacyl reductase 2 (.1) Potri.010G052500 182.55 0.8343
AT2G03810 18S pre-ribosomal assembly pro... Potri.015G048400 188.80 0.8092
AT1G24480 S-adenosyl-L-methionine-depend... Potri.015G088400 196.36 0.8069
AT1G61050 alpha 1,4-glycosyltransferase ... Potri.011G047700 206.93 0.8274
AT1G54820 Protein kinase superfamily pro... Potri.013G025700 219.38 0.8007
AT5G20270 HHP1 heptahelical transmembrane pro... Potri.006G064400 254.19 0.8057
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Potri.001G234500 274.73 0.8009

Potri.010G237600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.