Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10080 198 / 5e-64 RmlC-like cupins superfamily protein (.1) AT5G39160 150 / 3e-45 RmlC-like cupins superfamily protein (.1.2.3) AT3G05950 146 / 8e-44 RmlC-like cupins superfamily protein (.1) AT1G02335 145 / 1e-43 GL22 germin-like protein subfamily 2 member 2 precursor (.1) AT5G39190 145 / 1e-43 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT3G05930 145 / 2e-43 GLP8 germin-like protein 8 (.1) AT3G04200 145 / 2e-43 RmlC-like cupins superfamily protein (.1) AT5G39130 145 / 2e-43 RmlC-like cupins superfamily protein (.1) AT3G04150 143 / 1e-42 RmlC-like cupins superfamily protein (.1.2) AT1G18980 143 / 1e-42 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G238200 [exp] 275 / 2e-94 AT3G10080 263 / 7e-90 RmlC-like cupins superfamily protein (.1) Potri.008G020800 [exp] 273 / 6e-94 AT3G10080 263 / 7e-90 RmlC-like cupins superfamily protein (.1) Potri.009G140350 [exp] 149 / 8e-45 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Potri.009G140400 [exp] 149 / 9e-45 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1) Potri.011G163300 [exp] 145 / 1e-43 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163216 [exp] 145 / 1e-43 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.004G180000 [exp] 142 / 2e-42 AT5G39130 250 / 2e-84 RmlC-like cupins superfamily protein (.1) Potri.004G180200 [exp] 142 / 2e-42 AT5G39130 244 / 4e-82 RmlC-like cupins superfamily protein (.1) Potri.013G052000 [exp] 142 / 3e-42 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014192 [exp] 188 / 5e-60 AT3G10080 272 / 7e-93 RmlC-like cupins superfamily protein (.1) Lus10022721 [exp] 146 / 2e-44 ND 210 / 2e-69 Lus10035278 [exp] 144 / 9e-43 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 140 / 2e-41 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10030048 [exp] 139 / 4e-41 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10036658 [exp] 139 / 8e-41 AT1G18980 229 / 3e-76 RmlC-like cupins superfamily protein (.1) Lus10034254 [exp] 138 / 1e-40 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10035279 [exp] 137 / 4e-40 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3) Lus10032016 [exp] 135 / 1e-39 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10029010 [exp] 135 / 1e-39 AT3G05950 250 / 2e-84 RmlC-like cupins superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.010G238100.1 pacid=42799479 polypeptide=Potri.010G238100.1.p locus=Potri.010G238100 ID=Potri.010G238100.1.v4.1 annot-version=v4.1 ATGGCCTTAATGGTGAGAATCTTGTTTGTCATTCTCTTCATTGGCTTTGTGGCTTCTGACCCTAACCCGGTCCAAGACTACTGCATAGCCGTTACAGATT CTGAAACCTACATCCCATGCAAGAATCCATCACTTGTCACCGTAGAAGATTTCATATTTTCCGGTTTAAATTCTACAGGAAATTTCAGCGAAACAGGGCA AGCAGTACTTTCTGTCAATGTAAACAACTTTCCAGGACTAAGAACACAGGGTGTTTCACTTGCTCGTGCTGATTTTGAAGTTGGTGGTTTCGCTTTGCCT CATGCGCATCCAAGAGCAACAGAGGCTGTATGTGTGCTGGAGGGGACATTTTATTCAGGGTTTATTGATTCACAGCAAAAAGTTTTTGCTAAGGTGATTG AACAGGGTGACGTGATTGTAATTCCAAGGGGCCTAGTGCACTTCCATAAGAATATTGGAGAAATACAAGGAACACTCCTGGGCATCTATAACAGCGAAAA TCCTGGAAAGTCGATGTTTCCAACTGCGGCATTTGGATGTGAAGTGAAGGAAGAACTTTTCGAGAAGGTTTATGGATTGAGTGCGGAGGACATCTCCAAG GTGAGGGGAAAGTTACATTTGTGTGGAAAGGCTGAAGCTGGCTTTAATTAG
AA sequence Show only first row Show all	>Potri.010G238100.1 pacid=42799479 polypeptide=Potri.010G238100.1.p locus=Potri.010G238100 ID=Potri.010G238100.1.v4.1 annot-version=v4.1 MALMVRILFVILFIGFVASDPNPVQDYCIAVTDSETYIPCKNPSLVTVEDFIFSGLNSTGNFSETGQAVLSVNVNNFPGLRTQGVSLARADFEVGGFALP HAHPRATEAVCVLEGTFYSGFIDSQQKVFAKVIEQGDVIVIPRGLVHFHKNIGEIQGTLLGIYNSENPGKSMFPTAAFGCEVKEELFEKVYGLSAEDISK VRGKLHLCGKAEAGFN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10080			RmlC-like cupins superfamily p...		Potri.010G238100 [exp]	0	1
AT2G26110			Protein of unknown function (D...		Potri.001G008080 [exp]	1.41	0.9854
AT3G07600			Heavy metal transport/detoxifi...		Potri.009G048400 [exp]	4.89	0.9750
					Potri.002G021100 [exp]	5.29	0.9636
					Potri.002G122400 [exp]	6.48	0.9575
					Potri.007G076600 [exp]	7.74	0.9437
AT1G03220			Eukaryotic aspartyl protease f...		Potri.013G070325 [exp]	7.74	0.9456
AT1G03220			Eukaryotic aspartyl protease f...		Potri.013G070300 [exp]	8.36	0.9534
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G016900 [exp]	8.66	0.9427
AT5G42650		CYP74A, AOS, DD...	DELAYED DEHISCENCE 2, CYTOCHRO...		Potri.014G038700 [exp]	8.77	0.9448
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G190300 [exp]	9.21	0.9598	GRAS43

Compare expression of checked genes

Potri.010G238100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.