Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10080 263 / 6e-90 RmlC-like cupins superfamily protein (.1) AT1G02335 169 / 6e-53 GL22 germin-like protein subfamily 2 member 2 precursor (.1) AT3G62020 168 / 1e-52 GLP10 germin-like protein 10 (.1.2) AT1G18980 167 / 3e-52 RmlC-like cupins superfamily protein (.1) AT5G26700 163 / 9e-51 RmlC-like cupins superfamily protein (.1) AT1G18970 163 / 1e-50 GLP4 germin-like protein 4 (.1) AT1G09560 162 / 3e-50 GLP5 germin-like protein 5 (.1) AT3G05930 159 / 8e-49 GLP8 germin-like protein 8 (.1) AT5G38960 157 / 4e-48 RmlC-like cupins superfamily protein (.1) AT3G04200 155 / 2e-47 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G020800 [exp] 383 / 1e-137 AT3G10080 263 / 7e-90 RmlC-like cupins superfamily protein (.1) Potri.010G238100 [exp] 275 / 2e-94 AT3G10080 197 / 6e-64 RmlC-like cupins superfamily protein (.1) Potri.014G110400 [exp] 168 / 1e-52 AT3G62020 328 / 2e-115 germin-like protein 10 (.1.2) Potri.002G184900 [exp] 167 / 2e-52 AT3G62020 332 / 3e-117 germin-like protein 10 (.1.2) Potri.009G140400 [exp] 161 / 1e-49 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1) Potri.009G140350 [exp] 160 / 2e-49 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Potri.011G163300 [exp] 160 / 2e-49 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163800 [exp] 160 / 2e-49 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.015G068200 [exp] 159 / 5e-49 AT1G18980 247 / 2e-83 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014192 [exp] 253 / 1e-85 AT3G10080 272 / 7e-93 RmlC-like cupins superfamily protein (.1) Lus10022721 [exp] 213 / 2e-70 ND 210 / 2e-69 Lus10038014 [exp] 169 / 7e-53 AT3G62020 327 / 5e-115 germin-like protein 10 (.1.2) Lus10036658 [exp] 167 / 4e-52 AT1G18980 229 / 3e-76 RmlC-like cupins superfamily protein (.1) Lus10035278 [exp] 164 / 5e-51 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10032016 [exp] 162 / 5e-50 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10026962 [exp] 160 / 2e-49 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10030048 [exp] 160 / 3e-49 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10034254 [exp] 158 / 2e-48 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10009254 [exp] 157 / 7e-48 AT3G62020 306 / 1e-106 germin-like protein 10 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.010G238200.1 pacid=42797575 polypeptide=Potri.010G238200.1.p locus=Potri.010G238200 ID=Potri.010G238200.1.v4.1 annot-version=v4.1 ATGGCCTTAATGGTGGCAGTCTTTTTTGCCATTCTCTTTCAAGGTTATGTGTCCTTGGCTTCTGATCCTGATCCAGTTCGTGACTTCTGCTTAGCCAATA CTGATTCTGCAACCAACATCCCCTGCAAGAACTCATCGGATGCCACAGTAGAGGATTTCATATTTTCTGGGATCAAATCTCATGGAAAATTCAGTGAAAC GGGGCTAGCATCGATTCCTGTCAACGTGAATAACTTCCCGGGCCTGAACACACTAGGCATGTCACTTGTTCGTGCAGATTTTGAAGCTGGTGGTGTCAAT GTGCCTCATTTCCATCCAAGAGCAACAGAGGTTGCGTATGTGCTCGAGGGGAAGATTTATTCAGGATTTGTCGACACGCAGAACAAAGTTTTTGCTAAAG TGCTTGAAAAAGGTGAGGTCATGGTGTTTCCAAAGGGTCTAGTACACTTCCAGATGAATGTTGGAGATAAACCAGCAACTATTGTGGGCAGTTTTAATAG CGAAAATCCTGGATCGATGAAGATTCCTACTGCGGTATTCGGATGTGGAATCAAGGAAGAGCTTTTGGAGAAGGCTTTTGGGTTGAAGGGTAAGGACATC TCCAAGGTGAGGAAAAAGTTTCTTTCGTGTTAG
AA sequence Show only first row Show all	>Potri.010G238200.1 pacid=42797575 polypeptide=Potri.010G238200.1.p locus=Potri.010G238200 ID=Potri.010G238200.1.v4.1 annot-version=v4.1 MALMVAVFFAILFQGYVSLASDPDPVRDFCLANTDSATNIPCKNSSDATVEDFIFSGIKSHGKFSETGLASIPVNVNNFPGLNTLGMSLVRADFEAGGVN VPHFHPRATEVAYVLEGKIYSGFVDTQNKVFAKVLEKGEVMVFPKGLVHFQMNVGDKPATIVGSFNSENPGSMKIPTAVFGCGIKEELLEKAFGLKGKDI SKVRKKFLSC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10080			RmlC-like cupins superfamily p...		Potri.010G238200 [exp]	0	1
AT5G19320		RANGAP2	RAN GTPase activating protein ...		Potri.010G091100 [exp]	14.96	0.8661	Pt-RANGAP2.1
AT5G20100			unknown protein		Potri.018G029600 [exp]	27.82	0.7903
AT4G16630			DEA(D/H)-box RNA helicase fami...		Potri.002G020101 [exp]	27.92	0.8054
AT3G18670			Ankyrin repeat family protein ...		Potri.008G022900 [exp]	28.98	0.8446
AT1G80510			Transmembrane amino acid trans...		Potri.001G204400 [exp]	69.19	0.8151
AT5G04700			Ankyrin repeat family protein ...		Potri.008G023500 [exp]	92.66	0.8082
AT1G14540			Peroxidase superfamily protein...		Potri.008G022264 [exp]	102.46	0.8124
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Potri.003G204600 [exp]	130.74	0.7697
AT1G64585		RTFL22, DVL12	DEVIL 12, ROTUNDIFOLIA like 22...		Potri.001G087150 [exp]	132.00	0.7695
AT3G05890		RCI2B	RARE-COLD-INDUCIBLE 2B, Low te...		Potri.005G002250 [exp]	141.82	0.7992

Compare expression of checked genes

Potri.010G238200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.