Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16710 217 / 6e-74 Iron-sulphur cluster biosynthesis family protein (.1.2.3) AT2G36260 183 / 4e-61 Iron-sulphur cluster biosynthesis family protein (.1) AT1G10500 77 / 3e-18 ATCPISCA chloroplast-localized ISCA-like protein (.1) AT5G03905 64 / 1e-13 Iron-sulphur cluster biosynthesis family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G020400 [exp] 238 / 2e-82 AT2G16710 197 / 5e-66 Iron-sulphur cluster biosynthesis family protein (.1.2.3) Potri.007G079600 [exp] 75 / 1e-17 AT1G10500 210 / 5e-70 chloroplast-localized ISCA-like protein (.1) Potri.005G085400 [exp] 75 / 2e-17 AT1G10500 227 / 9e-77 chloroplast-localized ISCA-like protein (.1) Potri.006G084300 [exp] 67 / 7e-15 AT5G03905 199 / 2e-66 Iron-sulphur cluster biosynthesis family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017048 [exp] 201 / 2e-67 AT2G16710 220 / 5e-75 Iron-sulphur cluster biosynthesis family protein (.1.2.3) Lus10021368 [exp] 150 / 6e-46 AT2G16710 211 / 3e-69 Iron-sulphur cluster biosynthesis family protein (.1.2.3) Lus10020827 [exp] 76 / 6e-18 AT1G10500 216 / 1e-72 chloroplast-localized ISCA-like protein (.1) Lus10012683 [exp] 76 / 9e-18 AT1G10500 218 / 2e-73 chloroplast-localized ISCA-like protein (.1) Lus10014201 [exp] 66 / 2e-14 AT5G03905 204 / 2e-68 Iron-sulphur cluster biosynthesis family protein (.1) Lus10022714 [exp] 66 / 3e-14 AT5G03905 201 / 3e-67 Iron-sulphur cluster biosynthesis family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01521 [poplar] [flax] Fe-S_biosyn Iron-sulphur cluster biosynthesis
Representative CDS sequence Show only first row Show all	>Potri.010G238800.1 pacid=42799649 polypeptide=Potri.010G238800.1.p locus=Potri.010G238800 ID=Potri.010G238800.1.v4.1 annot-version=v4.1 ATGGCAGCTTCCAGAGCATCCAAACTTTTCGCAGCAGCAGCGGAGGCGGTAGGTTCCTCAGCCCGAAAACAAGTTCTAAGCTTGACGGACGCCGCCGCTA CCAGAATCCGGGACCTCTTGCAGCAGCGCAAACGCCCTTTTCTCCGCCTCGGCGTCAAAGCTCGCGGCTGCAATGGCTTGTCATACACTCTTAATTATGC AGATGAGAAAGGGAAATTTGATGAATTAGTTGAAGATAAAGGGGTGAAGATATTGATTGACCCAAAGGCGCTGATGCATGTTATTGGAACCAAGATGGAT TTTGTTGATGACAAGCTCAGATCTGAGTTCATTTTCATCAATCCCAACTCCAAAGGGCAGTGTGGTTGTGGAGAGTCGTTTATGACAAGAAGTAGTTCAA CAACCGCTAAAGGTGGTGGTAGTTAA
AA sequence Show only first row Show all	>Potri.010G238800.1 pacid=42799649 polypeptide=Potri.010G238800.1.p locus=Potri.010G238800 ID=Potri.010G238800.1.v4.1 annot-version=v4.1 MAASRASKLFAAAAEAVGSSARKQVLSLTDAAATRIRDLLQQRKRPFLRLGVKARGCNGLSYTLNYADEKGKFDELVEDKGVKILIDPKALMHVIGTKMD FVDDKLRSEFIFINPNSKGQCGCGESFMTRSSSTTAKGGGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16710			Iron-sulphur cluster biosynthe...		Potri.010G238800 [exp]	0	1
AT4G13270			Late embryogenesis abundant (L...		Potri.006G159400 [exp]	7.93	0.7199
AT3G09735			S1FA-like DNA-binding protein ...		Potri.016G087400 [exp]	9.94	0.6793	Pt-S1FA3.2
AT1G21780			BTB/POZ domain-containing prot...		Potri.002G082800 [exp]	20.19	0.6683
AT5G40190			RNA ligase/cyclic nucleotide p...		Potri.017G073800 [exp]	21.58	0.7143
AT2G25110		AtSDF2, ATSDL, ...	ATSDF2-LIKE, Arabidopsis thali...		Potri.006G263200 [exp]	26.87	0.6653
AT1G29260		PEX7, ATPEX7	ARABIDOPSIS PEROXIN 7, peroxin...		Potri.004G057600 [exp]	33.27	0.6481	PEX7.1
AT5G07960			unknown protein		Potri.012G065500 [exp]	34.58	0.6591
AT3G26400		EIF4B1	eukaryotic translation initiat...		Potri.010G048200 [exp]	35.09	0.6760	EIF4.3
AT5G11340			Acyl-CoA N-acyltransferases (N...		Potri.018G032400 [exp]	37.08	0.6873
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Potri.005G074900 [exp]	37.30	0.6685	Pt-UBP3.2

Compare expression of checked genes

Potri.010G238800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.