Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PETF.5
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27510 175 / 5e-57 ATFD3 ferredoxin 3 (.1) AT1G60950 148 / 1e-46 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT1G10960 141 / 1e-43 ATFD1 ferredoxin 1 (.1) AT5G10000 136 / 7e-42 ATFD4 ferredoxin 4 (.1) AT1G32550 81 / 1e-19 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) AT4G14890 77 / 3e-18 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G020100 [exp] 296 / 4e-105 AT2G27510 180 / 5e-59 ferredoxin 3 (.1) Potri.009G163800 [exp] 208 / 4e-70 AT2G27510 167 / 7e-54 ferredoxin 3 (.1) Potri.004G202500 [exp] 201 / 6e-67 AT2G27510 164 / 3e-52 ferredoxin 3 (.1) Potri.003G015200 [exp] 150 / 2e-47 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.004G218400 [exp] 144 / 7e-45 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.001G470700 [exp] 142 / 5e-44 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.003G090400 [exp] 81 / 2e-19 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Potri.010G087300 [exp] 75 / 1e-17 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.008G153200 [exp] 75 / 1e-17 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034144 [exp] 214 / 3e-72 AT2G27510 179 / 1e-58 ferredoxin 3 (.1) Lus10043430 [exp] 208 / 6e-70 AT2G27510 179 / 3e-58 ferredoxin 3 (.1) Lus10020616 [exp] 166 / 4e-53 AT2G27510 172 / 9e-56 ferredoxin 3 (.1) Lus10004870 [exp] 166 / 4e-53 AT2G27510 165 / 5e-53 ferredoxin 3 (.1) Lus10015462 [exp] 137 / 4e-42 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10001369 [exp] 132 / 4e-40 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10000483 [exp] 80 / 4e-19 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Lus10004576 [exp] 78 / 2e-18 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Lus10006116 [exp] 75 / 2e-17 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10010557 [exp] 75 / 6e-17 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0486 [poplar] [flax] Fer2 PF00111 [poplar] [flax] Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence Show only first row Show all	>Potri.010G239100.1 pacid=42796771 polypeptide=Potri.010G239100.1.p locus=Potri.010G239100 ID=Potri.010G239100.1.v4.1 annot-version=v4.1 ATGTCAACCGCGAGACTTCCCACAACATGCATGATCAGAAGCGCACCCCCAAGTAAAGTTGCAAGCCCAAGCAGATCATGTGCCTTGATCAAGAGCCCGG GTGCTTTGGGTTCTGCAATGAGCGTATCTAAAGCATTTGGCCTGAAGTCTTCGTCCTTCAAAGTATCTGCAATGGCAGTTTACAAAGTGAAACTAATCAT GCCAGATGGATGCGAGCACGAATTTGACGCCCCTGATGATACCTACATCCTTGATTCAGCTGAAAATGCAGGAGTGGAGCTCCCATACTCGTGCAGGGCC GGAGCCTGTTCTACTTGTGCTGGTATGATGGTTTCAGGATCCGTGGACCAATCAGATGGTTCATTCCTCGATGAAAAGCAGATGGAGAAGGGATACGTCC TTACATGCATCTCATATCCAACTTCGGACTCTGTGATCCACACACACAAGGAGGAAGACCTGTATTGA
AA sequence Show only first row Show all	>Potri.010G239100.1 pacid=42796771 polypeptide=Potri.010G239100.1.p locus=Potri.010G239100 ID=Potri.010G239100.1.v4.1 annot-version=v4.1 MSTARLPTTCMIRSAPPSKVASPSRSCALIKSPGALGSAMSVSKAFGLKSSSFKVSAMAVYKVKLIMPDGCEHEFDAPDDTYILDSAENAGVELPYSCRA GACSTCAGMMVSGSVDQSDGSFLDEKQMEKGYVLTCISYPTSDSVIHTHKEEDLY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27510		ATFD3	ferredoxin 3 (.1)		Potri.010G239100 [exp]	0	1	PETF.5
AT4G16210		ECHIA, E-COAH-2	ENOYL-COA HYDRATASE 2, enoyl-C...		Potri.008G104500 [exp]	6.70	0.6614
AT4G23740			Leucine-rich repeat protein ki...		Potri.015G023500 [exp]	12.32	0.6992
AT3G25640			Protein of unknown function, D...		Potri.010G131600 [exp]	12.40	0.6641
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Potri.011G139800 [exp]	14.14	0.6628	Pt-PSPK3.2
AT4G00820		IQD17	IQ-domain 17 (.1)		Potri.011G153400 [exp]	24.39	0.6945
AT2G17080			Arabidopsis protein of unknown...		Potri.005G248950 [exp]	37.62	0.6509
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	43.81	0.6162	SAUR6
AT1G76240			Arabidopsis protein of unknown...		Potri.002G011600 [exp]	53.60	0.5805
					Potri.016G037200 [exp]	76.83	0.5904
AT5G58560		FOLK	farnesol kinase, Phosphatidate...		Potri.009G074700 [exp]	111.57	0.6024

Compare expression of checked genes

Potri.010G239100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.