Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04750 57 / 5e-12 F1F0-ATPase inhibitor protein, putative (.1.2) AT2G27730 42 / 5e-06 copper ion binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G016801 [exp] 92 / 6e-26 AT5G04750 56 / 8e-12 F1F0-ATPase inhibitor protein, putative (.1.2) Potri.009G163100 [exp] 38 / 9e-05 AT2G27730 96 / 1e-26 copper ion binding (.1) Potri.004G201700 [exp] 37 / 0.0002 AT2G27730 60 / 1e-12 copper ion binding (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034146 [exp] 72 / 4e-18 AT5G04750 80 / 8e-21 F1F0-ATPase inhibitor protein, putative (.1.2) Lus10004865 [exp] 45 / 8e-07 AT2G27730 112 / 3e-32 copper ion binding (.1) Lus10020624 [exp] 39 / 4e-05 AT2G27730 108 / 7e-32 copper ion binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04568 [poplar] [flax] IATP Mitochondrial ATPase inhibitor, IATP
Representative CDS sequence Show only first row Show all	>Potri.010G240401.1 pacid=42798880 polypeptide=Potri.010G240401.1.p locus=Potri.010G240401 ID=Potri.010G240401.1.v4.1 annot-version=v4.1 ATGGCAACAAGATCCGCACTGAGCCGACTCAGCTTAATCACTATTCGCTCGATGAAGTCAACTCGTGGAGCTACTCGCTACTTCAGTGATGGCAAAGGTC GAGTTCTGAGCGAAGAGGAACGCGCTGCTGAAAACGTTTATATTCAGAAAATGGAGAGGGAAAGGTTGGAGAAACTGAAGCTAAAGCAGGAGAAGGAGAA GGCAGAGAAAGAGAAACAGGGTGCTGACAAGAGAATTGAAGGGAGCCAGAAAGCCTGA
AA sequence Show only first row Show all	>Potri.010G240401.1 pacid=42798880 polypeptide=Potri.010G240401.1.p locus=Potri.010G240401 ID=Potri.010G240401.1.v4.1 annot-version=v4.1 MATRSALSRLSLITIRSMKSTRGATRYFSDGKGRVLSEEERAAENVYIQKMERERLEKLKLKQEKEKAEKEKQGADKRIEGSQKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04750			F1F0-ATPase inhibitor protein,...		Potri.010G240401 [exp]	0	1
AT2G27800			Tetratricopeptide repeat (TPR)...		Potri.018G093700 [exp]	2.44	0.8195
AT5G10695			unknown protein		Potri.018G007300 [exp]	4.24	0.7921
AT3G11890			Sterile alpha motif (SAM) doma...		Potri.006G198500 [exp]	4.47	0.8021
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.014G019600 [exp]	5.74	0.8086
AT5G04750			F1F0-ATPase inhibitor protein,...		Potri.008G016801 [exp]	7.00	0.7351
AT2G38730			Cyclophilin-like peptidyl-prol...		Potri.001G030000 [exp]	8.36	0.8161
AT2G26970			Polynucleotidyl transferase, r...		Potri.001G222300 [exp]	8.77	0.7920
AT1G11360			Adenine nucleotide alpha hydro...		Potri.011G039800 [exp]	14.96	0.7747
AT5G61230		PIA2, ANK6	phytochrome interacting ankyri...		Potri.003G104400 [exp]	16.88	0.7690
AT5G49220			Protein of unknown function (D...		Potri.008G213300 [exp]	17.02	0.7980

Compare expression of checked genes

Potri.010G240401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.