Potri.010G241200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04800 228 / 2e-78 Ribosomal S17 family protein (.1.2.3.4)
AT2G05220 226 / 2e-77 Ribosomal S17 family protein (.1.2)
AT3G10610 226 / 2e-77 Ribosomal S17 family protein (.1)
AT2G04390 223 / 1e-76 Ribosomal S17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G017300 254 / 1e-88 AT5G04800 229 / 1e-78 Ribosomal S17 family protein (.1.2.3.4)
Potri.016G073750 173 / 9e-57 AT5G04800 171 / 5e-56 Ribosomal S17 family protein (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021307 228 / 4e-78 AT5G04800 231 / 9e-80 Ribosomal S17 family protein (.1.2.3.4)
Lus10004208 228 / 4e-78 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1)
Lus10029412 228 / 4e-78 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1)
Lus10041076 223 / 3e-76 AT5G04800 226 / 8e-78 Ribosomal S17 family protein (.1.2.3.4)
Lus10030344 225 / 8e-72 AT1G80560 655 / 0.0 ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 2, isopropylmalate dehydrogenase 2 (.1)
Lus10016985 140 / 3e-44 AT3G10610 143 / 1e-45 Ribosomal S17 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00833 Ribosomal_S17e Ribosomal S17
Representative CDS sequence
>Potri.010G241200.4 pacid=42798381 polypeptide=Potri.010G241200.4.p locus=Potri.010G241200 ID=Potri.010G241200.4.v4.1 annot-version=v4.1
ATGGGTCGTGTTCGTACCAAGACAGTGAAGAAGTCTTCACGCCAGGTCATTGAGAGGTACTACTCTAAAATGACCTTGGATTTCCACACCAACAAGAAGA
TTTTGGAAGAGGTTGCTATCATCCCCTCGAAGCGTCTCCGCAACAAGATTGCTGGGTTCTCTACCCATCTAATGAAGCGTATTCAGAAGGGACCAGTTCG
TGGCATCTCACTGAAACTACAAGAGGAAGAGCGTGAGCGTCGCATGGATTTCGTGCCTGAGGAGTCTGCCATTAAGATCCATGAGATTAAGGTTGACAAA
GAGACCATTGACATGCTTGCCGCTCTTGGGATGTCAGATGTTCCTGGGCTTGTTGAAGTTGAGCCTCAGCCTATGCTTCCCACTCAGGGATTCGGTAGAG
GAGGTGGTGCTAGGAGGTTCTTGAGTTAA
AA sequence
>Potri.010G241200.4 pacid=42798381 polypeptide=Potri.010G241200.4.p locus=Potri.010G241200 ID=Potri.010G241200.4.v4.1 annot-version=v4.1
MGRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPEESAIKIHEIKVDK
ETIDMLAALGMSDVPGLVEVEPQPMLPTQGFGRGGGARRFLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04800 Ribosomal S17 family protein (... Potri.010G241200 0 1
AT2G27710 60S acidic ribosomal protein f... Potri.009G146200 1.00 0.9878
AT2G42740 RPL16A ribosomal protein large subuni... Potri.011G069200 1.73 0.9763 L16.2
AT4G14320 Zinc-binding ribosomal protein... Potri.007G071800 2.23 0.9701
AT3G02560 Ribosomal protein S7e family p... Potri.004G099200 2.44 0.9790
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.006G202300 3.46 0.9698 Pt-RPL27.4
AT2G37190 Ribosomal protein L11 family p... Potri.006G077200 5.65 0.9686 RPL12.4
AT4G16720 Ribosomal protein L23/L15e fam... Potri.002G141500 5.74 0.9545 Pt-RPL15.6
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Potri.004G202832 6.00 0.9706
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Potri.015G111500 6.00 0.9677 Pt-UBI.4
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Potri.015G007100 6.32 0.9608 UBQ1.4

Potri.010G241200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.