Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26790 77 / 8e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G01740 72 / 2e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G19890 72 / 3e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G59900 69 / 4e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39710 69 / 5e-14 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G11690 66 / 3e-13 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G26680 62 / 7e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G13040 61 / 2e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G77340 61 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G17140 61 / 4e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G066600 [exp] 152 / 3e-43 AT2G26790 521 / 4e-174 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G166001 [exp] 82 / 1e-18 AT4G26680 697 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.001G139300 [exp] 72 / 3e-15 AT5G01110 275 / 1e-81 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G117600 [exp] 67 / 2e-13 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 66 / 3e-13 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.010G035700 [exp] 65 / 9e-13 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Potri.015G121700 [exp] 65 / 9e-13 AT4G19890 923 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G141800 [exp] 64 / 1e-12 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.006G271400 [exp] 64 / 1e-12 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005692 [exp] 112 / 4e-29 AT2G26790 469 / 4e-154 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10020299 [exp] 100 / 5e-25 AT2G26790 251 / 2e-75 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10020294 [exp] 86 / 4e-20 AT2G26790 207 / 9e-60 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009548 [exp] 72 / 2e-15 AT4G26680 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10016727 [exp] 68 / 1e-13 AT5G61990 345 / 2e-108 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016729 [exp] 67 / 1e-13 AT5G39710 243 / 4e-73 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027916 [exp] 67 / 2e-13 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036020 [exp] 67 / 2e-13 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013077 [exp] 65 / 9e-13 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003429 [exp] 64 / 1e-12 AT1G62930 173 / 1e-49 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.010G243002.1 pacid=42797999 polypeptide=Potri.010G243002.1.p locus=Potri.010G243002 ID=Potri.010G243002.1.v4.1 annot-version=v4.1 ATGTTTGACGAGGCTATTGATGTTCTTTTTCAAAATAGTAAGGTCCGTGGATTCGTTCCACGGATATGGTCATGTTACTGTCTCACGAACCTGTTGATTG AGTGTAGGATAGTGGAGATGGTTGTCGCCACTTATCAGCATTTACAGAGCATTGATTCGAGCCCAAATGATTATACATATACCCTTGCTATCGAGGCATT TTGTGTGAGAGGCGGTTCGGAGGAAGCGGTTGATGTCTTTTGGGAGATACAGGAACCTGGAGTGACTCCAAATGCTTTTGCTCACACAACATATATTGAA GGTCTTTGCACGCATCAGGGGTCAGATCCAGGCTGTAAGATGCTCCAGGGACTGACAAGAGTGAAGATTCCAATAGACGTTTATGTTTATACAGCTGTGA TTTGTGGCTTCTGTAATGAAATGAAATTGAAAAGGCAGAGAGTGTCTTGCTTGACATGGAAAAACAAGGCTTTGTAA
AA sequence Show only first row Show all	>Potri.010G243002.1 pacid=42797999 polypeptide=Potri.010G243002.1.p locus=Potri.010G243002 ID=Potri.010G243002.1.v4.1 annot-version=v4.1 MFDEAIDVLFQNSKVRGFVPRIWSCYCLTNLLIECRIVEMVVATYQHLQSIDSSPNDYTYTLAIEAFCVRGGSEEAVDVFWEIQEPGVTPNAFAHTTYIE GLCTHQGSDPGCKMLQGLTRVKIPIDVYVYTAVICGFCNEMKLKRQRVSCLTWKNKAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26790			Pentatricopeptide repeat (PPR)...		Potri.010G243002 [exp]	0	1
AT1G14200			RING/U-box superfamily protein...		Potri.019G086601 [exp]	1.73	0.8620
AT1G45231			S-adenosyl-L-methionine-depend...		Potri.014G028000 [exp]	2.23	0.8530
AT5G13710		CPH, SMT1	CEPHALOPOD, sterol methyltrans...		Potri.016G056000 [exp]	5.47	0.8283
AT1G56690			Pentatricopeptide repeat (PPR)...		Potri.013G005400 [exp]	6.92	0.8684
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Potri.009G106200 [exp]	13.03	0.8092	SQN.1
AT5G13230			Tetratricopeptide repeat (TPR)...		Potri.001G062566 [exp]	13.22	0.8481
AT5G05160		REDUCED IN LATE...	REDUCED IN LATERAL GROWTH1, Le...		Potri.001G209700 [exp]	13.41	0.8214
AT1G74350			Intron maturase, type II famil...		Potri.005G063750 [exp]	15.36	0.8590
AT1G77010			Pentatricopeptide repeat (PPR)...		Potri.002G075200 [exp]	18.49	0.8233
AT5G53220			unknown protein		Potri.015G022500 [exp]	19.20	0.8025

Compare expression of checked genes

Potri.010G243002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.