Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35910 114 / 3e-32 RING/U-box superfamily protein (.1) AT2G46160 105 / 2e-28 RING/U-box superfamily protein (.1) AT5G06490 94 / 2e-24 RING/U-box superfamily protein (.1) AT3G61550 93 / 8e-24 RING/U-box superfamily protein (.1) AT5G07040 91 / 1e-23 RING/U-box superfamily protein (.1) AT5G53110 84 / 2e-19 RING/U-box superfamily protein (.1) AT2G25409 76 / 1e-17 unknown protein AT5G27420 78 / 2e-17 CNI1, ATL31 carbon/nitrogen insensitive 1 (.1) AT3G05200 78 / 3e-17 ATL6 RING/U-box superfamily protein (.1) AT1G22500 77 / 4e-17 AtATL15 Arabidopsis thaliana Arabidopsis toxicos en levadura 15, RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G243400 [exp] 184 / 3e-60 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1) Potri.008G018900 [exp] 149 / 2e-46 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1) Potri.016G067900 [exp] 130 / 7e-39 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1) Potri.008G019000 [exp] 127 / 2e-37 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1) Potri.010G243200 [exp] 124 / 2e-36 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1) Potri.010G243500 [exp] 120 / 7e-35 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1) Potri.006G201500 [exp] 120 / 7e-35 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1) Potri.002G165200 [exp] 108 / 8e-30 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1) Potri.014G091000 [exp] 100 / 1e-26 AT3G61550 176 / 1e-55 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041079 [exp] 104 / 4e-28 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1) Lus10036404 [exp] 85 / 1e-21 AT3G61550 149 / 2e-46 RING/U-box superfamily protein (.1) Lus10005389 [exp] 85 / 3e-21 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1) Lus10024124 [exp] 85 / 6e-21 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1) Lus10012628 [exp] 88 / 8e-21 AT5G53110 284 / 5e-93 RING/U-box superfamily protein (.1) Lus10003400 [exp] 82 / 5e-20 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1) Lus10019018 [exp] 84 / 2e-19 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1) Lus10023086 [exp] 83 / 4e-19 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1) Lus10034153 [exp] 80 / 4e-19 AT2G17450 79 / 2e-18 RING-H2 finger A3A (.1) Lus10031515 [exp] 82 / 5e-19 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.010G243300.2 pacid=42797236 polypeptide=Potri.010G243300.2.p locus=Potri.010G243300 ID=Potri.010G243300.2.v4.1 annot-version=v4.1 ATGAACAGCTCCCCTGAGCACAGTCATCAGTCAAGTTTTTGTGGTATAGGATGTGCCATGGTAATTTCTTTTGGCATCCTACTTTTGATCATTATCATAA TTTTTGCCTCATATATCTGCACCCATGGCATACAAGATCCTTCCAGACTCACCCCTAGCAACGAAGGCAGCTCCATTACTGACCAAGGCTCCGTTGCAAT TAATCCCGGCCTTGATGAAGCCACTCTTGCAAGCTACCCTAAGTTGCTATATTCACAAGAAAAGTCTCAACAAAAGGTTAATCATTCACTAGATTCTTGC TGTTCTATATGCTTGGGGGACTATATAGACAGTGATGTGTTAAGGTTATTGCCTCATTGTGGTCATACTTTTCATCTTAATTGTGTGGACTGTTGGTTAA GGCTGAATCATACATGCCCGATATGCCGGAACTTGCCTGTGCCTACTTTCTCGATTCCTCTTGCTGAAGTGGCACCATTGGCTACGTACAGATATTGA
AA sequence Show only first row Show all	>Potri.010G243300.2 pacid=42797236 polypeptide=Potri.010G243300.2.p locus=Potri.010G243300 ID=Potri.010G243300.2.v4.1 annot-version=v4.1 MNSSPEHSHQSSFCGIGCAMVISFGILLLIIIIIFASYICTHGIQDPSRLTPSNEGSSITDQGSVAINPGLDEATLASYPKLLYSQEKSQQKVNHSLDSC CSICLGDYIDSDVLRLLPHCGHTFHLNCVDCWLRLNHTCPICRNLPVPTFSIPLAEVAPLATYRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35910			RING/U-box superfamily protein...		Potri.010G243300 [exp]	0	1
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Potri.004G052400 [exp]	10.95	0.8449
AT5G13150		ATEXO70C1	exocyst subunit exo70 family p...		Potri.001G060700 [exp]	12.16	0.8312
AT1G19190			alpha/beta-Hydrolases superfam...		Potri.004G142900 [exp]	17.74	0.8170
					Potri.005G086300 [exp]	26.53	0.7570
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Potri.019G014302 [exp]	33.64	0.8173
AT3G53420		PIP2;1, PIP2A	PLASMA MEMBRANE INTRINSIC PROT...		Potri.008G039600 [exp]	37.10	0.8041	Pt-MDPIP1.2
					Potri.004G140000 [exp]	38.61	0.8133
AT5G24850		CRY3	cryptochrome 3 (.1)		Potri.006G277500 [exp]	42.19	0.8003
AT4G35160			O-methyltransferase family pro...		Potri.013G121300 [exp]	48.74	0.7325	OOMT2.16
AT1G18330	MYB	RVE7, EPR1	REVEILLE 7, EARLY-PHYTOCHROME-...		Potri.012G038300 [exp]	49.95	0.6824	Pt-EPR1.2

Compare expression of checked genes

Potri.010G243300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.