Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06490 112 / 8e-32 RING/U-box superfamily protein (.1) AT2G35910 108 / 6e-30 RING/U-box superfamily protein (.1) AT2G25409 93 / 2e-24 unknown protein AT5G07040 90 / 3e-23 RING/U-box superfamily protein (.1) AT5G53110 93 / 1e-22 RING/U-box superfamily protein (.1) AT2G25410 91 / 3e-22 RING/U-box superfamily protein (.1) AT3G61550 87 / 1e-21 RING/U-box superfamily protein (.1) AT2G46160 86 / 4e-21 RING/U-box superfamily protein (.1) AT5G27420 87 / 2e-20 CNI1, ATL31 carbon/nitrogen insensitive 1 (.1) AT2G46495 87 / 2e-20 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G243200 [exp] 225 / 2e-76 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1) Potri.008G019000 [exp] 197 / 4e-65 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1) Potri.016G067900 [exp] 127 / 9e-38 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1) Potri.010G243400 [exp] 127 / 1e-37 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1) Potri.006G201500 [exp] 115 / 6e-33 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1) Potri.010G243300 [exp] 108 / 2e-30 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1) Potri.008G018900 [exp] 105 / 4e-29 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1) Potri.002G165200 [exp] 93 / 4e-24 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1) Potri.002G170300 [exp] 94 / 4e-23 AT2G46495 317 / 4e-106 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023086 [exp] 95 / 4e-23 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1) Lus10003400 [exp] 89 / 7e-23 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1) Lus10012628 [exp] 93 / 1e-22 AT5G53110 284 / 5e-93 RING/U-box superfamily protein (.1) Lus10032382 [exp] 91 / 5e-22 AT5G53110 237 / 1e-74 RING/U-box superfamily protein (.1) Lus10041079 [exp] 86 / 3e-21 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1) Lus10019018 [exp] 87 / 1e-20 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1) Lus10000333 [exp] 87 / 1e-20 AT3G05200 309 / 2e-102 RING/U-box superfamily protein (.1) Lus10034153 [exp] 82 / 3e-20 AT2G17450 79 / 2e-18 RING-H2 finger A3A (.1) Lus10005389 [exp] 82 / 3e-20 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1) Lus10031515 [exp] 85 / 7e-20 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.010G243500.1 pacid=42798265 polypeptide=Potri.010G243500.1.p locus=Potri.010G243500 ID=Potri.010G243500.1.v4.1 annot-version=v4.1 ATGAATAGCAGTCGTCCTGTAGAGCACTCATCAGCAACAGTTTTTGGTGGGTTTGCTCTCATTTTTGGAATATCCATAGGTGTTGTTTCAGCAATAGCAA TGGTCATTCTTGTTTACTATTTCTGCACACGGAAACCAATACCAAATGACCCTTCTGTGGACGATGGCTCCTCATCTGATGGCGATCCTGTTACTATTAA AATAGGCCTGGATGAAGCCACTCTTGATACCTATCCAAAGCTGCTTTATTCTGAAGCAAAGGAAAGGCTTGAAAAGGGTGATGATTCGGTCGCTGCTTCC AATTGCTCAATTTGCTTGGCAGACTATACAGATAGTGACTTGCTGCGGCTGTTGCCTGAGTGTAATCACCTTTTCCATTCACAGTGCATTGATCCATGGT TCAAGCTGCATACTACTTGCCCCGTATGTCGAAACTCGCCTTCCAGGCCACCTCAGCGAGAATTCTTTGGTACATGGTTTCTACGGTTTGTGCATTAA
AA sequence Show only first row Show all	>Potri.010G243500.1 pacid=42798265 polypeptide=Potri.010G243500.1.p locus=Potri.010G243500 ID=Potri.010G243500.1.v4.1 annot-version=v4.1 MNSSRPVEHSSATVFGGFALIFGISIGVVSAIAMVILVYYFCTRKPIPNDPSVDDGSSSDGDPVTIKIGLDEATLDTYPKLLYSEAKERLEKGDDSVAAS NCSICLADYTDSDLLRLLPECNHLFHSQCIDPWFKLHTTCPVCRNSPSRPPQREFFGTWFLRFVH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06490			RING/U-box superfamily protein...		Potri.010G243500 [exp]	0	1
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Potri.006G089600 [exp]	1.00	0.9797	RBE.2
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G123400 [exp]	3.16	0.9756
AT2G48140		EDA4	embryo sac development arrest ...		Potri.005G212000 [exp]	3.46	0.9745
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Potri.016G101400 [exp]	3.87	0.9714	RBE.1
AT4G22810	AT-hook		Predicted AT-hook DNA-binding ...		Potri.003G116900 [exp]	4.58	0.9746
AT2G03830		RGF8	root meristem growth factor 8,...		Potri.010G138001 [exp]	6.00	0.9692
					Potri.013G117300 [exp]	6.00	0.9709
AT4G03965			RING/U-box superfamily protein...		Potri.004G003101 [exp]	6.16	0.9553
AT3G09220		LAC7	laccase 7 (.1)		Potri.006G094100 [exp]	6.32	0.9702	LAC110a
AT1G27040			Major facilitator superfamily ...		Potri.014G036200 [exp]	8.12	0.9535

Compare expression of checked genes

Potri.010G243500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.