Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27940 62 / 6e-12 RING/U-box superfamily protein (.1) AT3G60220 61 / 2e-11 ATL4 TOXICOS EN LEVADURA 4 (.1) AT1G74620 61 / 3e-11 RING/U-box superfamily protein (.1) AT2G18670 58 / 1e-10 RING/U-box superfamily protein (.1) AT5G41450 57 / 1e-10 RING/U-box superfamily protein (.1) AT3G20395 58 / 2e-10 RING/U-box superfamily protein (.1) AT2G44578 56 / 2e-10 RING/U-box superfamily protein (.1) AT5G10380 58 / 3e-10 ATRING1, RING1 RING/U-box superfamily protein (.1) AT4G12190 54 / 3e-10 RING/U-box superfamily protein (.1) AT5G07040 56 / 5e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G400600 [exp] 97 / 8e-26 AT2G20650 59 / 8e-11 RING/U-box superfamily protein (.1.2) Potri.011G119900 [exp] 94 / 9e-25 AT1G14200 60 / 9e-12 RING/U-box superfamily protein (.1) Potri.005G244800 [exp] 61 / 2e-11 AT4G35840 132 / 3e-38 RING/U-box superfamily protein (.1) Potri.007G061400 [exp] 59 / 1e-10 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2) Potri.005G090500 [exp] 59 / 2e-10 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.003G139900 [exp] 59 / 2e-10 AT5G53110 253 / 3e-81 RING/U-box superfamily protein (.1) Potri.001G091700 [exp] 58 / 2e-10 AT5G53110 223 / 1e-69 RING/U-box superfamily protein (.1) Potri.013G095100 [exp] 58 / 2e-10 AT4G10150 159 / 3e-48 RING/U-box superfamily protein (.1) Potri.011G147900 [exp] 57 / 2e-10 AT5G47610 123 / 1e-35 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027736 [exp] 62 / 4e-12 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1) Lus10021524 [exp] 59 / 7e-11 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1) Lus10023055 [exp] 58 / 2e-10 AT4G24015 181 / 5e-58 RING/U-box superfamily protein (.1) Lus10028406 [exp] 58 / 2e-10 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1) Lus10041859 [exp] 58 / 2e-10 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1) Lus10008797 [exp] 58 / 3e-10 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1) Lus10024405 [exp] 56 / 5e-10 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1) Lus10016163 [exp] 57 / 6e-10 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1) Lus10022223 [exp] 57 / 6e-10 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1) Lus10040942 [exp] 56 / 7e-10 AT3G11110 109 / 1e-30 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.010G245801.1 pacid=42798274 polypeptide=Potri.010G245801.1.p locus=Potri.010G245801 ID=Potri.010G245801.1.v4.1 annot-version=v4.1 ATGCTAGATCTCGTTCTTTCCGTGTCCATCCTTATTGTGTTTGTAGCGGTTGTCTTTAGTCTTGCAGTTATACCAATTTGTGTGCATTGGTATCGTGAAA AAGATCAACATCTTCGTGATCTTGAGAGAGGAGAAGTAACTCAAAGTCCACAGTTTGAAGATCAACATCCTCATGACCTTGAAAGAGTAGAGGAAGCTAG AAGACGACAACTTGCTACAATTTCATTACTGATATTGCATCTAACTCGTGTTCAAAGCGATGATGAAAGGATAGTGACATCAAGAAATAATGGGTGCGTG ATATGCCTGGAGGATTTCCAGGAGGGAGAGGATTGCCAGGCCATGTCTTTGTGCAAGCATGTTTTCCATTCAGGTTGCCTTAAAGAATGGCTTGTTCAGA ACCAGACCTGTCCACTTTGTCGACTCCCAGTATTGCTTGAAGTTTTTCTTTATATCTGTCGTGTTCGATTTATCATTCGTTGGGTGCTCGTCTTTTCCTT GGTCAATCAACACGAATCTTTTATGTAA
AA sequence Show only first row Show all	>Potri.010G245801.1 pacid=42798274 polypeptide=Potri.010G245801.1.p locus=Potri.010G245801 ID=Potri.010G245801.1.v4.1 annot-version=v4.1 MLDLVLSVSILIVFVAVVFSLAVIPICVHWYREKDQHLRDLERGEVTQSPQFEDQHPHDLERVEEARRRQLATISLLILHLTRVQSDDERIVTSRNNGCV ICLEDFQEGEDCQAMSLCKHVFHSGCLKEWLVQNQTCPLCRLPVLLEVFLYICRVRFIIRWVLVFSLVNQHESFM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27940			RING/U-box superfamily protein...		Potri.010G245801 [exp]	0	1
AT1G22220		AUF2	auxin up-regulated f-box prote...		Potri.001G021900 [exp]	3.16	0.7142
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	18.70	0.6818
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	19.36	0.6818
AT2G19320			unknown protein		Potri.006G073300 [exp]	19.59	0.6046
ATMG00640		ATMG00640.1, OR...	hydrogen ion transporting ATP ...		Potri.007G062422 [exp]	20.71	0.7336
AT1G79010			Alpha-helical ferredoxin (.1)		Potri.004G154900 [exp]	25.09	0.6082
AT3G02100			UDP-Glycosyltransferase superf...		Potri.010G084900 [exp]	27.92	0.6545
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Potri.013G108500 [exp]	41.27	0.7091
AT3G02645			Plant protein of unknown funct...		Potri.017G062900 [exp]	44.69	0.6466
AT3G30387			Protein of unknown function (D...		Potri.017G039125 [exp]	50.82	0.5978

Compare expression of checked genes

Potri.010G245801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.