Plant FIBer expression Database

Potri.010G248550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G075000
[exp]
103 / 1e-27 AT3G48150 957 / 0.0 anaphase-promoting complex subunit 8 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004242
[exp]
53 / 1e-09 AT3G48150 895 / 0.0 anaphase-promoting complex subunit 8 (.1)
Lus10042152
[exp]
49 / 3e-08 AT3G48150 904 / 0.0 anaphase-promoting complex subunit 8 (.1)
PFAM info
Representative CDS sequence
>Potri.010G248550.1 pacid=42798022 polypeptide=Potri.010G248550.1.p locus=Potri.010G248550 ID=Potri.010G248550.1.v4.1 annot-version=v4.1
ATGGATGAGCTCGAAAGAGACTTGCTGGAGCGAGCTTCACGTTGCCACTCGCCAACTAAGCGATCGCTGCCTTTACGCTGCTTCCAAATGGGCAGGGGAG
CAACTGTTGTGAATCGAGCAAGACCCTGCAAAGTTCACTCCTACAAACACCAGATTCCAACGTGGAAGTTGCAGCATTCATCGAAGAAGATTCCGAACTA
G
AA sequence
>Potri.010G248550.1 pacid=42798022 polypeptide=Potri.010G248550.1.p locus=Potri.010G248550 ID=Potri.010G248550.1.v4.1 annot-version=v4.1
MDELERDLLERASRCHSPTKRSLPLRCFQMGRGATVVNRARPCKVHSYKHQIPTWKLQHSSKKIPN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G48150 CDC23, APC8 anaphase-promoting complex sub... Potri.010G248550
[exp]
0 1
AT1G62280 SLAH1 SLAC1 homologue 1 (.1) Potri.010G170050
[exp]
3.74 0.8480
AT2G43770 Transducin/WD40 repeat-like su... Potri.019G096900
[exp]
4.35 0.8561
AT3G56690 CIP111 Cam interacting protein 111 (.... Potri.016G032666
[exp]
4.89 0.8330
AT1G51200 A20/AN1-like zinc finger famil... Potri.003G205500
[exp]
11.74 0.8133
AT3G26410 TRM11, AtTRM11 tRNA modification 11, methyltr... Potri.001G207000
[exp]
13.96 0.8217
Potri.015G068850
[exp]
15.00 0.7980
Potri.015G072666
[exp]
17.88 0.8000
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.013G118400
[exp]
19.33 0.7920
Potri.001G269850
[exp]
21.63 0.7750
Potri.019G089100
[exp]
24.18 0.7382

Potri.010G248550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.