Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73050 164 / 1e-48 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT5G51950 93 / 8e-23 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) AT1G72970 91 / 4e-22 HTH, EDA17 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) AT1G12570 89 / 2e-21 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT5G51930 86 / 2e-20 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT3G56060 81 / 1e-18 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT1G14185 65 / 4e-13 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT1G14190 64 / 1e-12 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G009600 [exp] 188 / 5e-58 AT1G73050 785 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.001G111500 [exp] 91 / 3e-22 AT1G12570 773 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.001G200800 [exp] 89 / 3e-21 AT1G72970 831 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Potri.003G039000 [exp] 88 / 3e-21 AT1G72970 808 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Potri.010G168200 [exp] 69 / 2e-14 AT1G14190 598 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.008G087400 [exp] 67 / 7e-14 AT1G14185 639 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.010G168100 [exp] 66 / 2e-13 AT1G14185 654 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.012G135200 [exp] 58 / 1e-10 AT5G51950 525 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034845 [exp] 174 / 5e-53 AT1G73050 699 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10033390 [exp] 173 / 6e-53 AT1G73050 697 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10024487 [exp] 93 / 9e-23 AT1G12570 709 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10003176 [exp] 91 / 3e-22 AT1G72970 822 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10015623 [exp] 89 / 3e-21 AT1G72970 777 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10017827 [exp] 87 / 9e-21 AT1G12570 710 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10037640 [exp] 85 / 5e-20 AT1G72970 768 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10038891 [exp] 84 / 9e-20 AT5G51950 668 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Lus10002957 [exp] 84 / 1e-19 AT1G12570 701 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10027406 [exp] 83 / 3e-19 AT5G51950 694 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00732 [poplar] [flax] GMC_oxred_N GMC oxidoreductase
Representative CDS sequence Show only first row Show all	>Potri.010G249501.1 pacid=42798279 polypeptide=Potri.010G249501.1.p locus=Potri.010G249501 ID=Potri.010G249501.1.v4.1 annot-version=v4.1 ATGGTGCGTGAAAAAGGTGAAATGATGCTATCTGCTGGTGCCATTGGGAGTCCACAGTTACTTCTTTTAAGTGGCATTGGCCCAAGGTCTTACCTTTCTT CTATGGGGATTCCAGTGGCTTACCATCTTCCATATGTGGGCCAATACCTCTATGATAATCCTCGCAATGGGATCTCAATTGTGACTCCAACGCCACTGGA GCATTCACTGATTCAGGTGGTTGGTATTTCTGAGGTGGGAGCTTATCTTGAAGCAGCTTCAACAGTTATCCCCTTTGCATCCCCTGCCCAAGGTGTTTTT ATTAGGACACCTTCATCACCTTTAATTATATCTCACAGTGGCCACCCTTATGGAGGAAATTGTTGGGCTGCTCTCAATCGGGTCACTAAGGCTGGTTTCC ACAGATGTTAG
AA sequence Show only first row Show all	>Potri.010G249501.1 pacid=42798279 polypeptide=Potri.010G249501.1.p locus=Potri.010G249501 ID=Potri.010G249501.1.v4.1 annot-version=v4.1 MVREKGEMMLSAGAIGSPQLLLLSGIGPRSYLSSMGIPVAYHLPYVGQYLYDNPRNGISIVTPTPLEHSLIQVVGISEVGAYLEAASTVIPFASPAQGVF IRTPSSPLIISHSGHPYGGNCWAALNRVTKAGFHRC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73050			Glucose-methanol-choline (GMC)...		Potri.010G249501 [exp]	0	1
AT1G70140		ATFH8	formin 8 (.1)		Potri.008G192900 [exp]	8.00	0.7721
AT2G23360			Plant protein of unknown funct...		Potri.007G046100 [exp]	16.55	0.7397
AT5G43020			Leucine-rich repeat protein ki...		Potri.014G024400 [exp]	18.89	0.7309
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182000 [exp]	21.16	0.7092
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182321 [exp]	21.90	0.7054
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.005G200400 [exp]	22.24	0.7004
					Potri.005G162201 [exp]	24.65	0.7254
AT3G57620			glyoxal oxidase-related protei...		Potri.013G034900 [exp]	25.33	0.7116
AT5G51950			Glucose-methanol-choline (GMC)...		Potri.012G135200 [exp]	25.45	0.6372
AT1G34220			Regulator of Vps4 activity in ...		Potri.013G117100 [exp]	27.49	0.6849

Compare expression of checked genes

Potri.010G249501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.