Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30130 110 / 4e-31 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G31320 105 / 3e-29 AS2 LBD4 LOB domain-containing protein 4 (.1) AT3G26660 103 / 7e-29 AS2 LBD24 LOB domain-containing protein 24 (.1) AT3G26620 103 / 7e-29 AS2 LBD23 LOB domain-containing protein 23 (.1) AT2G23660 107 / 1e-28 AS2 LBD10 LOB domain-containing protein 10 (.1.2) AT2G28500 103 / 6e-28 AS2 LBD11 LOB domain-containing protein 11 (.1) AT1G07900 102 / 1e-27 AS2 LBD1 LOB domain-containing protein 1 (.1) AT5G63090 101 / 1e-27 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT5G66870 104 / 2e-27 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT3G27650 100 / 4e-27 AS2 LBD25 LOB domain-containing protein 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G133800 [exp] 122 / 7e-33 AT3G26660 160 / 3e-46 LOB domain-containing protein 24 (.1) Potri.015G135900 [exp] 113 / 2e-32 AT3G26660 165 / 2e-53 LOB domain-containing protein 24 (.1) Potri.005G097800 [exp] 111 / 8e-32 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.001G081400 [exp] 111 / 1e-31 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 110 / 4e-31 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 107 / 2e-30 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.009G076900 [exp] 105 / 4e-29 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G043900 [exp] 105 / 9e-29 AT1G07900 218 / 2e-72 LOB domain-containing protein 1 (.1) Potri.010G217700 [exp] 105 / 1e-28 AT1G07900 203 / 1e-66 LOB domain-containing protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023434 [exp] 137 / 5e-42 AT3G26660 131 / 5e-40 LOB domain-containing protein 24 (.1) Lus10040313 [exp] 136 / 2e-41 AT5G66870 133 / 5e-40 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Lus10018993 [exp] 126 / 2e-37 AT3G26660 134 / 2e-41 LOB domain-containing protein 24 (.1) Lus10033843 [exp] 120 / 7e-35 AT1G07900 143 / 8e-44 LOB domain-containing protein 1 (.1) Lus10040638 [exp] 109 / 9e-31 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10018275 [exp] 108 / 3e-30 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10040373 [exp] 106 / 7e-29 AT2G28500 211 / 7e-69 LOB domain-containing protein 11 (.1) Lus10031191 [exp] 103 / 7e-29 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10031769 [exp] 103 / 1e-28 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1) Lus10031285 [exp] 103 / 2e-28 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [poplar] [flax] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Potri.010G250700.2 pacid=42798313 polypeptide=Potri.010G250700.2.p locus=Potri.010G250700 ID=Potri.010G250700.2.v4.1 annot-version=v4.1 ATGTCCAATTCAACAAGATGCGCAGCTTGCAGATTTTTGAGAAGAAGATGCCGTCAAGATTGTGTCTTGGCTCCATATTTTCCTCCAACCAATCCCCAAA GATTTGCTTATGTCCATAAAGTCTTTGGTGCCAGCAAGATTACTGAATTGCTAAAGCAACTTCCGGTGCATTTACGTTATGATGCAGCAGAGTGCATGTC AATTGAGGCAGCATCGCGTGCAAGAGACCCAGTTTATGGATGTGTTGGAGTCATATCTCAGCTGCAACAACAAATAATTGATGTTCAATCTGAGTTGGTG AAGATAAAGGGTAAATTAGCAGTTCACAATGCTCAGCAACAACTACAACTAGAAGATGGAGAGAGGGCTAGTGAGCAGCAGCAAGATGAACTTTTATGGC TTGGTTCGACTCAACATGACCCTTTGAATTTGGATCAACTGCTAATCCAAGCAAATGATTACCAAAAATCCCACTTTTAG
AA sequence Show only first row Show all	>Potri.010G250700.2 pacid=42798313 polypeptide=Potri.010G250700.2.p locus=Potri.010G250700 ID=Potri.010G250700.2.v4.1 annot-version=v4.1 MSNSTRCAACRFLRRRCRQDCVLAPYFPPTNPQRFAYVHKVFGASKITELLKQLPVHLRYDAAECMSIEAASRARDPVYGCVGVISQLQQQIIDVQSELV KIKGKLAVHNAQQQLQLEDGERASEQQQDELLWLGSTQHDPLNLDQLLIQANDYQKSHF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Potri.010G250700 [exp]	0	1
AT2G17380		AP19	associated protein 19 (.1)		Potri.002G001800 [exp]	18.97	0.9149
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Potri.004G040700 [exp]	22.64	0.9183
AT2G33460		RIC1	ROP-interactive CRIB motif-con...		Potri.008G168900 [exp]	28.42	0.9150	Pt-RIC1.1
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.005G224700 [exp]	36.56	0.9138	GY4.2
					Potri.016G032550 [exp]	42.21	0.9125
AT1G01800			NAD(P)-binding Rossmann-fold s...		Potri.002G156750 [exp]	43.35	0.9124
AT2G04100			MATE efflux family protein (.1...		Potri.017G120500 [exp]	47.49	0.9117
AT5G05800			unknown protein		Potri.014G061450 [exp]	57.72	0.9111
AT3G46850			Subtilase family protein (.1)		Potri.009G038001 [exp]	57.87	0.9105
					Potri.009G020201 [exp]	61.02	0.9111

Compare expression of checked genes

Potri.010G250700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.