Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14320 175 / 2e-58 Zinc-binding ribosomal protein family protein (.1.2) AT3G23390 175 / 2e-58 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G071800 [exp] 180 / 2e-60 AT4G14320 175 / 2e-58 Zinc-binding ribosomal protein family protein (.1.2) Potri.005G092500 [exp] 176 / 5e-59 AT4G14320 171 / 4e-57 Zinc-binding ribosomal protein family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040983 [exp] 178 / 2e-59 AT3G23390 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1) Lus10038130 [exp] 178 / 2e-59 AT4G14320 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1.2) Lus10013436 [exp] 178 / 2e-59 AT3G23390 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1) Lus10010195 [exp] 178 / 2e-59 AT4G14320 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1.2) Lus10000176 [exp] 178 / 2e-59 AT4G14320 199 / 4e-68 Zinc-binding ribosomal protein family protein (.1.2) Lus10017396 [exp] 177 / 4e-59 AT4G14320 199 / 7e-68 Zinc-binding ribosomal protein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF00935 [poplar] [flax] Ribosomal_L44 Ribosomal protein L44
Representative CDS sequence Show only first row Show all	>Potri.010G251500.1 pacid=42799757 polypeptide=Potri.010G251500.1.p locus=Potri.010G251500 ID=Potri.010G251500.1.v4.1 annot-version=v4.1 ATGGTGAACGTTCCCAAGACAAAGAAGACTTATTGCAAGAACAAGGAGTGCAAAAAGCACACTTTGCACAAGGTCACACAGTACAAGAAGGGGAAGGATA GCCTAGCTGCTCAAGGAAAGCGCCGTTATGATCGCAAACAGTCAGGTTATGGAGGTCAGACCAAGCCTGTATTCCACAAGAAGGCTAAAACGACCAAGAA GATTGTCTTGAGGTTGCAATGCCAGAGTTGCAAGCACGTGTCCCAGCACCCCATCAAGAGGTGCAAGCACTTTGAGATTGGTGGAGATAAGAAGGGCAAG GGGACATCGCTGTTTTAG
AA sequence Show only first row Show all	>Potri.010G251500.1 pacid=42799757 polypeptide=Potri.010G251500.1.p locus=Potri.010G251500 ID=Potri.010G251500.1.v4.1 annot-version=v4.1 MVNVPKTKKTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQSCKHVSQHPIKRCKHFEIGGDKKGK GTSLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14320			Zinc-binding ribosomal protein...		Potri.010G251500 [exp]	0	1
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Potri.013G071100 [exp]	2.44	0.8321	TFCFA,Pt-KIS.1
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.010G245400 [exp]	3.16	0.8840	Pt-RPS28.1
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Potri.009G071250 [exp]	7.34	0.7912
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013000 [exp]	8.12	0.8073
AT5G25940			early nodulin-related (.1)		Potri.019G033700 [exp]	9.53	0.7961
AT4G38800		ATMTN1, ATMTAN1	ARABIDOPSIS METHYLTHIOADENOSIN...		Potri.004G167200 [exp]	11.53	0.7604
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.009G090000 [exp]	13.11	0.8162
AT5G17190			unknown protein		Potri.008G133600 [exp]	16.00	0.7635
AT1G49740			PLC-like phosphodiesterases su...		Potri.004G140200 [exp]	16.24	0.7350
AT1G02140		MAGO, HAP1, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.014G049700 [exp]	16.49	0.7941

Compare expression of checked genes

Potri.010G251500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.