Potri.010G255500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08410 78 / 4e-18 FTRA2 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
AT5G23440 78 / 4e-18 FTRA1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G002200 148 / 8e-46 AT5G08410 103 / 3e-28 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013448 89 / 8e-23 AT5G08410 130 / 5e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Lus10041002 89 / 1e-22 AT5G08410 130 / 8e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0610 ETAP PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Representative CDS sequence
>Potri.010G255500.1 pacid=42799296 polypeptide=Potri.010G255500.1.p locus=Potri.010G255500 ID=Potri.010G255500.1.v4.1 annot-version=v4.1
ATGGGCACGAGTGGGGCGTTATCGTCGGGAGCCGCCGCAGCCTGTTCGGCTTTCCGTTGCACAGATATCACCAAATTCAAATTCAAATTCAAATCCAATG
CCTTATTTTCACCAAATCCAAGGCGTAACTGCTGCTGCTACTCAATTATTACTCCTACTTGCACTGCCACAGTAGCATCTACATCTTCATCTTCCTCTAC
AGCAGCAGCAAGTAGTACTTGTAGCAGAGGAAGAAGAAAAACACTAGTTTCATGCTCGGTGGCTTTACGGTCCAACAATTCCGCAACCATGGTGACAGAA
GATGAGGAAGAGGAAGCGAAGAAGAAGATTGGAGCGAAGGTTAGGGTGAAGGTTCCGGTGAAGGTTTACCACGTGCCTCGAGTGGCGGAGGAATTGGATC
TGTGTGGATTGGAAGGTGAGGTGAAGCAGTACGTGAACCTGTGGAAGGGGAGGCGAGTTTCAGCTAATCTTCCTTACAAGATTCAGTTTGTCCATTCAGG
AGGAGTCAAGTTCTTTGCTCATCTCAGAGAGGATGAGTTGGAATTCCTTGATTGA
AA sequence
>Potri.010G255500.1 pacid=42799296 polypeptide=Potri.010G255500.1.p locus=Potri.010G255500 ID=Potri.010G255500.1.v4.1 annot-version=v4.1
MGTSGALSSGAAAACSAFRCTDITKFKFKFKSNALFSPNPRRNCCCYSIITPTCTATVASTSSSSSTAAASSTCSRGRRKTLVSCSVALRSNNSATMVTE
DEEEEAKKKIGAKVRVKVPVKVYHVPRVAEELDLCGLEGEVKQYVNLWKGRRVSANLPYKIQFVHSGGVKFFAHLREDELEFLD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Potri.010G255500 0 1
AT5G01920 STN8 State transition 8, Protein ki... Potri.006G109700 1.00 0.9889
AT1G19150 LHCA2*1, LHCA2*... photosystem I light harvesting... Potri.006G139600 1.41 0.9884 Lhca6,Pt-LHCA2*1.1
AT1G66840 PMI2, WEB2 WEAK CHLOROPLAST MOVEMENT UNDE... Potri.017G118900 3.16 0.9812
AT4G12800 PSAL photosystem I subunit l (.1) Potri.002G239700 6.32 0.9720 Pt-PSAL.3
AT1G03600 PSB27 photosystem II family protein ... Potri.002G056300 6.48 0.9739
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Potri.008G101100 6.48 0.9839
AT5G57930 APO2, EMB1629 embryo defective 1629, ACCUMUL... Potri.006G183900 6.48 0.9796
AT4G13510 ATAMT1;1, AMT1;... ARABIDOPSIS THALIANA AMMONIUM ... Potri.008G173800 7.93 0.9718 3,Pt-AMT1.5
AT4G04640 ATPC1 ATPase, F1 complex, gamma subu... Potri.004G014850 8.83 0.9804
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Potri.010G089400 8.94 0.9790 PSAD1.1

Potri.010G255500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.