Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36130 70 / 6e-17 Cytochrome P450 superfamily protein (.1) AT5G36110 71 / 4e-16 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT2G42850 66 / 2e-14 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT2G29090 62 / 4e-13 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT3G19270 55 / 2e-10 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT4G19230 54 / 5e-10 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT5G45340 53 / 9e-10 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT4G36380 53 / 9e-10 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT3G13730 52 / 1e-09 CYP90D1 "cytochrome P450, family 90, subfamily D, polypeptide 1", cytochrome P450, family 90, subfamily D, polypeptide 1 (.1) AT1G05160 51 / 5e-09 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G017800 [exp] 119 / 2e-33 AT5G36110 317 / 1e-103 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001500 [exp] 118 / 4e-33 AT5G36110 331 / 8e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001300 [exp] 108 / 2e-29 AT5G36110 332 / 2e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017700 [exp] 104 / 5e-28 AT5G36110 304 / 2e-98 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017633 [exp] 104 / 5e-28 AT5G36110 301 / 3e-97 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G137750 [exp] 88 / 1e-23 AT2G42850 175 / 6e-53 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Potri.001G425675 [exp] 88 / 3e-22 AT2G42850 246 / 4e-77 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Potri.019G078600 [exp] 76 / 6e-18 AT5G36110 476 / 2e-165 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106100 [exp] 75 / 1e-17 AT5G36110 470 / 4e-163 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040055 [exp] 86 / 3e-21 AT5G36110 318 / 7e-104 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Lus10028594 [exp] 63 / 3e-13 AT5G45340 299 / 1e-96 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10018898 [exp] 63 / 3e-13 AT5G45340 301 / 3e-97 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10010940 [exp] 61 / 3e-12 AT2G42850 571 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10031391 [exp] 57 / 7e-12 AT2G42850 141 / 8e-41 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10035685 [exp] 57 / 4e-11 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10040193 [exp] 56 / 8e-11 AT5G05690 687 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10019858 [exp] 56 / 1e-10 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10016065 [exp] 54 / 3e-10 AT3G50660 399 / 3e-134 SUPPRESSOR OF NPH4 2, SHADE AVOIDANCE 1, PARTIALLY SUPPRESSING COI1 INSENSITIVITY TO JA 1, DWARF 4, CYTOCHROME P450 90B1, CLOMAZONE-RESISTANT, Cytochrome P450 superfamily protein (.1) Lus10030404 [exp] 54 / 3e-10 AT5G05690 531 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.011G001350.1 pacid=42781596 polypeptide=Potri.011G001350.1.p locus=Potri.011G001350 ID=Potri.011G001350.1.v4.1 annot-version=v4.1 ATGGATAACTGTCTTTTCCCAGATTCAATGAACTTCGATCCAAAGCATTTCGATATGCAAATCCCACCGTATAGTTTTGTGGCATTCAGGGGAGGAGCGC GAATATGCCCTGGGTATGAATTTGCAAGACTTGAAACTCTGATTACAATGCATTACCTGGTGAACAGGTTCACATGGAAGCGCTGTATCCCTGACATTTC TTTTCCGGAGATCCAATGCCAGCTTTAA
AA sequence Show only first row Show all	>Potri.011G001350.1 pacid=42781596 polypeptide=Potri.011G001350.1.p locus=Potri.011G001350 ID=Potri.011G001350.1.v4.1 annot-version=v4.1 MDNCLFPDSMNFDPKHFDMQIPPYSFVAFRGGARICPGYEFARLETLITMHYLVNRFTWKRCIPDISFPEIQCQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36130			Cytochrome P450 superfamily pr...		Potri.011G001350 [exp]	0	1
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.011G001500 [exp]	1.73	0.8559	CYP728D4
AT1G25425		CLE43	CLAVATA3/ESR-RELATED 43 (.1)		Potri.010G124900 [exp]	2.00	0.8211
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Potri.007G133000 [exp]	22.13	0.8448
AT3G58060			Cation efflux family protein (...		Potri.001G010300 [exp]	26.45	0.7830
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Potri.008G082700 [exp]	29.93	0.7622
AT5G15180			Peroxidase superfamily protein...		Potri.007G122200 [exp]	31.74	0.8200
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Potri.008G071600 [exp]	38.14	0.8208
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.001G003000 [exp]	41.18	0.8096
AT1G01490			Heavy metal transport/detoxifi...		Potri.003G132200 [exp]	50.40	0.8015
AT5G10050			NAD(P)-binding Rossmann-fold s...		Potri.005G080900 [exp]	54.49	0.8062

Compare expression of checked genes

Potri.011G001350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.