Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36110 92 / 3e-22 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT5G36140 85 / 6e-20 CYP716A2 "cytochrome P450, family 716, subfamily A, polypeptide 2", cytochrome P450, family 716, subfamily A, polypeptide 2 (.1) AT1G12740 75 / 4e-16 CYP87A2 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) AT5G05690 68 / 1e-13 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT2G42850 66 / 4e-13 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT5G48000 64 / 2e-12 THAH1, THAH, CYP708A2 THALIANOL HYDROXYLASE 1, THALIANOL HYDROXYLASE, "cytochrome P450, family 708, subfamily A, polypeptide 2", cytochrome P450, family 708, subfamily A, polypeptide 2 (.1.2.3.4.5) AT3G13730 60 / 7e-11 CYP90D1 "cytochrome P450, family 90, subfamily D, polypeptide 1", cytochrome P450, family 90, subfamily D, polypeptide 1 (.1) AT1G19630 58 / 4e-10 CYP722A1 "cytochrome P450, family 722, subfamily A, polypeptide 1", cytochrome P450, family 722, subfamily A, polypeptide 1 (.1) AT3G44970 58 / 4e-10 Cytochrome P450 superfamily protein (.1) AT1G55940 56 / 1e-09 CYP708A1 "cytochrome P450, family 708, subfamily A, polypeptide 1", cytochrome P450, family 708, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G017800 [exp] 226 / 2e-72 AT5G36110 317 / 1e-103 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001300 [exp] 222 / 6e-71 AT5G36110 332 / 2e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001500 [exp] 210 / 3e-66 AT5G36110 331 / 8e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017700 [exp] 207 / 3e-65 AT5G36110 304 / 2e-98 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017633 [exp] 203 / 7e-64 AT5G36110 301 / 3e-97 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G137800 [exp] 158 / 3e-48 AT5G36110 157 / 1e-44 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G057901 [exp] 108 / 8e-28 AT5G36110 279 / 2e-88 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.012G115000 [exp] 99 / 2e-24 AT5G36110 295 / 7e-95 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G137950 [exp] 98 / 2e-24 AT5G36110 261 / 7e-83 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040055 [exp] 144 / 3e-41 AT5G36110 318 / 7e-104 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Lus10017839 [exp] 74 / 9e-16 AT1G12740 640 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10024495 [exp] 74 / 2e-15 AT1G12740 751 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10010940 [exp] 68 / 1e-13 AT2G42850 571 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10014850 [exp] 66 / 7e-13 AT5G05690 679 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10000647 [exp] 61 / 4e-11 AT3G30180 540 / 0.0 brassinosteroid-6-oxidase 2 (.1) Lus10040193 [exp] 61 / 4e-11 AT5G05690 687 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10024272 [exp] 59 / 2e-10 AT1G19630 592 / 0.0 "cytochrome P450, family 722, subfamily A, polypeptide 1", cytochrome P450, family 722, subfamily A, polypeptide 1 (.1) Lus10014240 [exp] 58 / 4e-10 AT3G30180 531 / 0.0 brassinosteroid-6-oxidase 2 (.1) Lus10022299 [exp] 57 / 5e-10 AT3G50660 132 / 3e-36 SUPPRESSOR OF NPH4 2, SHADE AVOIDANCE 1, PARTIALLY SUPPRESSING COI1 INSENSITIVITY TO JA 1, DWARF 4, CYTOCHROME P450 90B1, CLOMAZONE-RESISTANT, Cytochrome P450 superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G001401.1 pacid=42781329 polypeptide=Potri.011G001401.1.p locus=Potri.011G001401 ID=Potri.011G001401.1.v4.1 annot-version=v4.1 ATGAATCTTGAAATGTTTTTCGTCTTGCTTTTCTTACTTCTACCACTCTACCTTCTCCTGAGACAGAGAATTTCAGGAAGGTTTCCACCGGGTTCTTTAG GGTTACCCATCATTGGCCAAAGTATCACCTTCCGGCCGCATGCCATGCGCAAAAATACAGATGAAGAATGGCTACGGATTAGAATAAGAAAATACGTTCC CGTCTGGAAAACGAGCCTCCTTGGGAAACCAACAGTGTTCCTGTCTGGGGCTGCAAACAAGTTCATCTACAATTGTGATGGTAGCATTCTTGCCGGTCAG AAACCGCTGTCGGTGAGGAGGATTTGTGGTCAGAGGAATATTTTTGAATTGAGTGGCCATGAGCACAAGCGCGTCAGAGGAGTACTGGTATCACTCTTAA AGCCTGAAGTGTTAAGGCAACATGTCGGTGAGATGGATGAAAGAATCAGAAAGCATTTCGAGATGCATTGGCATGGAAAGCAGAAGGTTTCTGTATGTCC ATTTTATCTAACAACAAAATATCAGCACATCTCTTAA
AA sequence Show only first row Show all	>Potri.011G001401.1 pacid=42781329 polypeptide=Potri.011G001401.1.p locus=Potri.011G001401 ID=Potri.011G001401.1.v4.1 annot-version=v4.1 MNLEMFFVLLFLLLPLYLLLRQRISGRFPPGSLGLPIIGQSITFRPHAMRKNTDEEWLRIRIRKYVPVWKTSLLGKPTVFLSGAANKFIYNCDGSILAGQ KPLSVRRICGQRNIFELSGHEHKRVRGVLVSLLKPEVLRQHVGEMDERIRKHFEMHWHGKQKVSVCPFYLTTKYQHIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.011G001401 [exp]	0	1
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.011G001300 [exp]	1.00	0.9842
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.002G080400 [exp]	3.74	0.9712
					Potri.005G081100 [exp]	5.19	0.9704
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Potri.019G023600 [exp]	5.29	0.9803
AT4G35270		NLP2	Plant regulator RWP-RK family ...		Potri.009G166400 [exp]	6.32	0.9773
AT2G23770			protein kinase family protein ...		Potri.009G010300 [exp]	7.74	0.9752
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.002G039600 [exp]	7.93	0.9781
AT5G14650			Pectin lyase-like superfamily ...		Potri.001G346800 [exp]	11.48	0.9724
					Potri.010G247750 [exp]	12.16	0.9308
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Potri.008G071600 [exp]	14.69	0.9551

Compare expression of checked genes

Potri.011G001401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.