Potri.011G005100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 189 / 5e-56 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 159 / 1e-44 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 156 / 3e-43 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 154 / 1e-42 Mitochondrial transcription termination factor family protein (.1.2)
AT1G62110 146 / 2e-39 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 145 / 5e-39 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 138 / 1e-36 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 136 / 5e-36 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 129 / 3e-33 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G012400 603 / 0 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 594 / 0 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 586 / 0 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 573 / 0 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 447 / 7e-157 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 358 / 4e-122 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 276 / 7e-90 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 274 / 5e-89 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 271 / 4e-88 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040820 234 / 2e-73 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 234 / 2e-73 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 217 / 5e-67 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 211 / 6e-65 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 197 / 3e-59 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 162 / 5e-46 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 157 / 2e-45 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 151 / 7e-43 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 134 / 3e-36 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 124 / 1e-31 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.011G005100.1 pacid=42780803 polypeptide=Potri.011G005100.1.p locus=Potri.011G005100 ID=Potri.011G005100.1.v4.1 annot-version=v4.1
ATGTTTAGGTTTCTCTGCAAAAGCTTGGGGTTAGGATGCTCCATTAGACCTAGTTCATCAGTTCATCAAGAATTACACTATTTTCTTGAAAACCCTTCAA
TATTATCATGCCTCAGAAACATTTCATCTGTGAATTCAGATGATGTAAAAGAACACTCCTTTACAGTATCATACCTTATGAACATTTGTGGGTTCTCTCT
AAAACCTGCTTTAGAAGTTTCTAAACAGGTTCATTTTGAAACCCCAGGTAATGCTGATTCTGTTCTTGAGATTTTCAAGAACCATGGCTTCTCAAAGGCC
CATATTTTGAACCTTGTGAGGAGATGGCCTAGAGTGCTTTTGTGTAAACCTCACAGAACACTCTTGCCCAAGCTTGGATTTTTCCATTCTAAAGGGTTTT
CAAGCCCTGATGTTGTCAAAATTATATCAACCTATCCGTGGATTTTGAGAATTAGCTTTGAAAACAAGTTAGTCCCTGCTTTTGATTTCTTTGAAAATTT
GCTCCAATCTGATGCCATGGCTATCAAAGCAGTCAAACTTGACCCGCGCCTTCTAGATGCTGGTCTTGAAAAGGCCGCACGTATTGTTGATATTTTGTTA
GAAAATGGAGTCCCTATGAAGAATATTGCTCTATCAGTTCGGATAAAGCCTGGTATTATGCTTTCGAATCTGGAGAATTTCAAAAGGCTTGTTCAGAAAG
CAAGTCTAATGGGATTTCATCCTTCCAAGAGTCAATTTGTTGTAGCAATTGTGTTGCTGAGGTCCATGACCACATCCACATGGGAAAAAAAGCTTGATGT
GTATAGGAGATGGGGTTTGTCTCAAGAAGAAATTCTTGCAGCATTTGTAAAGAATCCTTGGTTTATGAGCTTATCTGAAGAGAAGATCACGGCAGTGATG
GATCTTTTTGTCAACCAATTGGGTTGGGAGTCTTCCTATCTTGCCAAAAACCCAACTATACCATCATATAGCCTGGACAAAAGGCTTGTTCCAAGGGCTT
TGTTATTGCAATTTCTAGTTTCTAAAGGCTTGGTTGAGAAGAGTTTCAGAAGCACTGCGTTCTTCTACACACCTGAAAATAAGTTCCGGCAGATGTTCAT
AAATCACCGTTCTGAATCTACCCAGATATTGAAATTTTACAATGAAAAACTGAATCTTTCATCAGTTGTAAACTCTTCTACATTTTAA
AA sequence
>Potri.011G005100.1 pacid=42780803 polypeptide=Potri.011G005100.1.p locus=Potri.011G005100 ID=Potri.011G005100.1.v4.1 annot-version=v4.1
MFRFLCKSLGLGCSIRPSSSVHQELHYFLENPSILSCLRNISSVNSDDVKEHSFTVSYLMNICGFSLKPALEVSKQVHFETPGNADSVLEIFKNHGFSKA
HILNLVRRWPRVLLCKPHRTLLPKLGFFHSKGFSSPDVVKIISTYPWILRISFENKLVPAFDFFENLLQSDAMAIKAVKLDPRLLDAGLEKAARIVDILL
ENGVPMKNIALSVRIKPGIMLSNLENFKRLVQKASLMGFHPSKSQFVVAIVLLRSMTTSTWEKKLDVYRRWGLSQEEILAAFVKNPWFMSLSEEKITAVM
DLFVNQLGWESSYLAKNPTIPSYSLDKRLVPRALLLQFLVSKGLVEKSFRSTAFFYTPENKFRQMFINHRSESTQILKFYNEKLNLSSVVNSSTF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.011G005100 0 1
AT3G28730 NFD, SSRP1, ATH... NUCLEOSOME/CHROMATIN ASSEMBLY ... Potri.017G078500 2.82 0.9124 HMGB906,ATHMG.1
AT3G07870 F-box and associated interacti... Potri.001G396800 3.16 0.8932
Potri.012G100001 3.46 0.8972
AT4G20325 unknown protein Potri.006G280600 5.47 0.9033
AT4G01810 Sec23/Sec24 protein transport ... Potri.002G187100 7.34 0.8897
AT1G79870 D-isomer specific 2-hydroxyaci... Potri.013G046150 7.74 0.8777
AT3G14840 Leucine-rich repeat transmembr... Potri.019G009800 7.74 0.8639
AT5G07610 F-box family protein (.1) Potri.008G016300 7.93 0.8867
AT2G13290 beta-1,4-N-acetylglucosaminylt... Potri.018G127900 12.36 0.8780
Potri.010G007250 12.40 0.8645

Potri.011G005100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.