Potri.011G007100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04470 229 / 2e-77 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT4G14305 226 / 4e-76 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT5G19750 68 / 7e-14 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT5G43140 58 / 2e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT3G24570 58 / 2e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT4G33905 41 / 0.0002 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT2G14860 41 / 0.0002 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G008700 296 / 6e-104 AT4G04470 209 / 2e-69 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.010G068900 185 / 5e-60 AT4G14305 252 / 1e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.004G009201 102 / 7e-29 AT4G14305 72 / 2e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.016G029700 73 / 2e-15 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.006G032500 71 / 1e-14 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.018G081600 64 / 1e-12 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.018G037100 62 / 8e-12 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.009G090600 43 / 4e-05 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020027 246 / 6e-84 AT4G04470 259 / 2e-89 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10011798 202 / 9e-67 AT4G14305 262 / 1e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10034922 71 / 2e-15 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10023648 71 / 4e-15 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10012098 67 / 2e-13 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10010446 66 / 6e-13 AT5G19750 258 / 2e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10039003 65 / 8e-13 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10038626 62 / 4e-12 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10011679 61 / 2e-11 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10022130 54 / 6e-09 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence
>Potri.011G007100.1 pacid=42782440 polypeptide=Potri.011G007100.1.p locus=Potri.011G007100 ID=Potri.011G007100.1.v4.1 annot-version=v4.1
ATGGGATCAGTAGCAAAGAAGGGACTGCAACAGTATATGTTACAGCTTCAACAACACCCCTTAAGAACTAAGGCAATTACAGCAGGGGTGTTGTCAGCTC
TCAGTGACATAGTATCACAGAAACTCTCTGGCATTCAGAAACTTCAAATTAAAAGGATTTTGCTCAAAGTGCTTTTTGGGTTTGGATATCTTGGACCATT
CGGCCATTACCTACATATACTACTGGATAAACTTTTCAAGGGAAAGAAGGATACAACAACAGTTGCCAAGAAGGTGGCAGTGGAGCAGTTGACAGCTTCT
CCTTGGAACAACTTGGTTTTCATGGTTTATTATGGGATGGTTATCGATGGAAGACCCTGGTTGCAGGTGAAAACTAAACTGAAGAAGGAATACCCAGCAG
TGCAGTTCACATCATGGACGTTCTGGCCTGTTGTCGGGTGGGTAAATCACCAGTACATACCACAGCAATTCCGTGTCATCTTCCACAGCCTTATCGCAGT
CGGCTGGGGAATATTTCTGAATCTCCGAGCAAGGTCCATGGCGTTGACCAAAGGCTAA
AA sequence
>Potri.011G007100.1 pacid=42782440 polypeptide=Potri.011G007100.1.p locus=Potri.011G007100 ID=Potri.011G007100.1.v4.1 annot-version=v4.1
MGSVAKKGLQQYMLQLQQHPLRTKAITAGVLSALSDIVSQKLSGIQKLQIKRILLKVLFGFGYLGPFGHYLHILLDKLFKGKKDTTTVAKKVAVEQLTAS
PWNNLVFMVYYGMVIDGRPWLQVKTKLKKEYPAVQFTSWTFWPVVGWVNHQYIPQQFRVIFHSLIAVGWGIFLNLRARSMALTKG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G04470 PMP22 Peroxisomal membrane 22 kDa (M... Potri.011G007100 0 1
AT2G31570 ATGPX2 glutathione peroxidase 2 (.1) Potri.007G126600 1.00 0.7947
AT5G64500 Major facilitator superfamily ... Potri.009G081100 3.87 0.7243
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Potri.014G096000 5.29 0.7449 Pt-ADGT.3
AT3G19420 PTEN2A, ATPEN2 phosphatase and TENsin homolog... Potri.001G302000 6.48 0.7278
AT5G47530 Auxin-responsive family protei... Potri.006G015000 10.58 0.6955
AT1G55760 BTB/POZ domain-containing prot... Potri.001G468700 15.16 0.7464
AT1G34670 MYB ATMYB93 myb domain protein 93 (.1) Potri.002G096800 15.55 0.7098
AT3G04090 SIP1A, SIP1;1 small and basic intrinsic prot... Potri.013G053400 15.90 0.7328 SIP1.3
AT3G21240 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1) Potri.003G188500 16.67 0.7569 Pt-4CL.4
AT2G37770 ChlAKR, AKR4C9 Chloroplastic aldo-keto reduct... Potri.008G144600 20.78 0.7392

Potri.011G007100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.