Potri.011G007200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 279 / 6e-96 B-cell receptor-associated 31-like (.1)
AT1G11905 256 / 4e-87 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 148 / 1e-44 B-cell receptor-associated protein 31-like (.1)
AT3G07190 142 / 2e-42 B-cell receptor-associated protein 31-like (.1)
AT3G20450 122 / 2e-35 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G007900 394 / 1e-141 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.014G154800 232 / 1e-77 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 176 / 2e-55 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 170 / 5e-53 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 142 / 2e-43 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020025 287 / 3e-99 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10031546 242 / 2e-81 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10030043 224 / 1e-74 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10015132 219 / 2e-72 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10035283 209 / 1e-68 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10011842 176 / 2e-55 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10038188 169 / 1e-52 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Lus10022777 167 / 9e-52 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10000048 116 / 2e-33 AT1G11905 81 / 3e-20 B-cell receptor-associated protein 31-like (.1.2)
Lus10025914 61 / 1e-12 AT3G07190 66 / 7e-15 B-cell receptor-associated protein 31-like (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05529 Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence
>Potri.011G007200.1 pacid=42781773 polypeptide=Potri.011G007200.1.p locus=Potri.011G007200 ID=Potri.011G007200.1.v4.1 annot-version=v4.1
ATGATTCAGCTTTTGTTTACAGTGATATTTTCAGAGATGGCAATGATATTGTTATTTGTTTTCAAGACCCCATTAAGGAAATTGTTGATAATGAGCTTGG
ATCGAGTCAAGAGAGGGCGGGGACCAGTCATGGTTAAGACAGTTGCAGGGACAGTGTTTGTGGTTTTAATGTCAAGTGTTTATAGTATGGTGAAGATCCA
GAAACGTTGGATCGATGATGGTGGTGCTGTTAATCCTACAGACCAGGTTCTTCTGGCTAAACATCTGCTGGAGGCTACTCTTATGGGTTCCATCCTTTTT
CTTGGACTAATGATAGACCGACTGCACCATTATATTAGAGAACTCCGTATGAGGAGGAAGACCATGGAGGATGTAAAGAAACAAAATCGAAGTTTTGAGG
ATGGGAAGGTTGAGGAGACCAAAGCATTAGAAGCAGAGGCATCCACACTGCGAGAAAAACTTAAACAGCTGGAATCTGAATTGGAAATCAAGACAAAGGT
GGTAAATACATCAGAAGCCAATGCAGTTGCTCTAAGTAAGCAATCTGAAGGGTTCCTTCTTGAGTATGATCGTTTGCTTGAAGAGAACCAGAACCTAAGG
AGCCAGTTGCAATCTCTGGACTTGAGATTTTCACGTTCAACTAGCAAGAAGAATACTTGA
AA sequence
>Potri.011G007200.1 pacid=42781773 polypeptide=Potri.011G007200.1.p locus=Potri.011G007200 ID=Potri.011G007200.1.v4.1 annot-version=v4.1
MIQLLFTVIFSEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRWIDDGGAVNPTDQVLLAKHLLEATLMGSILF
LGLMIDRLHHYIRELRMRRKTMEDVKKQNRSFEDGKVEETKALEAEASTLREKLKQLESELEIKTKVVNTSEANAVALSKQSEGFLLEYDRLLEENQNLR
SQLQSLDLRFSRSTSKKNT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42570 B-cell receptor-associated 31-... Potri.011G007200 0 1
AT3G56750 unknown protein Potri.006G040400 3.16 0.9169
AT5G37310 Endomembrane protein 70 protei... Potri.017G144181 5.19 0.9250
AT1G52780 Protein of unknown function (D... Potri.001G175600 6.92 0.9167
AT1G43580 Sphingomyelin synthetase famil... Potri.005G193300 8.48 0.8836
AT2G40540 ATKUP2, ATKT2, ... potassium transporter 2 (.1.2) Potri.015G034200 8.77 0.8701
AT2G38840 Guanylate-binding family prote... Potri.002G046000 11.40 0.8737
AT5G26330 Cupredoxin superfamily protein... Potri.010G089900 11.83 0.9108
AT3G24040 Core-2/I-branching beta-1,6-N-... Potri.001G053800 13.41 0.8898
AT5G23860 TUB8, b-TUB tubulin beta 8 (.1.2) Potri.011G162500 13.74 0.8910 Pt-TUB4.1
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Potri.002G146500 14.42 0.9020

Potri.011G007200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.