Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1) AT4G26880 66 / 4e-14 Stigma-specific Stig1 family protein (.1) AT1G50720 63 / 4e-13 Stigma-specific Stig1 family protein (.1) AT5G55110 56 / 2e-10 Stigma-specific Stig1 family protein (.1) AT1G50650 49 / 9e-08 Stigma-specific Stig1 family protein (.1) AT1G53130 49 / 1e-07 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G007100 [exp] 169 / 2e-54 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007000 [exp] 159 / 1e-50 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007200 [exp] 158 / 2e-49 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.011G008804 [exp] 132 / 4e-40 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1) Potri.011G009100 [exp] 132 / 5e-40 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 130 / 4e-39 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G006800 [exp] 119 / 4e-35 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1) Potri.004G030900 [exp] 117 / 4e-34 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 111 / 6e-32 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020831 [exp] 79 / 3e-19 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 77 / 4e-18 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 57 / 2e-10 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 56 / 4e-10 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 52 / 1e-08 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1) Lus10041930 [exp] 49 / 1e-07 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 49 / 2e-07 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1) Lus10005544 [exp] 44 / 2e-06 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10006512 [exp] 40 / 0.0001 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [poplar] [flax] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Potri.011G008932.1 pacid=42781587 polypeptide=Potri.011G008932.1.p locus=Potri.011G008932 ID=Potri.011G008932.1.v4.1 annot-version=v4.1 ATGAAGTCTCTTACGATATACTTGTTGCTAGCTATGCTCATGGCCTTAGCTTATACTCTATCTGCTACAACTGAAGAAGACTCGTTCGTGGCCATCGAAA ATGATGATGATTCCACAAACGAGGATGAAAATACTGATCTTCCCTGGCTTGGTACCCAAGAAACAACATCTTCTTTGCGAGGGGCAAACCGGTTTCTAGC TCAGAAAACTCGGGCTGCCATGACATGCAATAAGTACCCTAGGGTTTGTCGTGCCAAGGGCAGCCCCGGGCCGGATTGCTGCAAGAAGAAGTGTGTGAAT GTGCTGACAGACAGGCTTAACTGTGGAATGTGTGGTAAGAAGTGCAAGTACGCTGAGATATGCTGCAAAGGTGATTGTGTGAAGCCAATGTCTAACAAGA AGCATTGTGGGGGTTGCAACAACAAGTGCAAGAAAGGGAATGCATGTGTGTATGGAATGTGTAGTTATGCATAG
AA sequence Show only first row Show all	>Potri.011G008932.1 pacid=42781587 polypeptide=Potri.011G008932.1.p locus=Potri.011G008932 ID=Potri.011G008932.1.v4.1 annot-version=v4.1 MKSLTIYLLLAMLMALAYTLSATTEEDSFVAIENDDDSTNEDENTDLPWLGTQETTSSLRGANRFLAQKTRAAMTCNKYPRVCRAKGSPGPDCCKKKCVN VLTDRLNCGMCGKKCKYAEICCKGDCVKPMSNKKHCGGCNNKCKKGNACVYGMCSYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11925			Stigma-specific Stig1 family p...		Potri.011G008932 [exp]	0	1
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G172866 [exp]	3.74	0.8082
AT3G59850			Pectin lyase-like superfamily ...		Potri.017G006200 [exp]	9.59	0.7036
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Potri.018G095000 [exp]	17.49	0.7086
AT3G59850			Pectin lyase-like superfamily ...		Potri.007G144400 [exp]	20.71	0.6722
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024200 [exp]	20.85	0.6970	CHIB1.1
AT4G34880			Amidase family protein (.1)		Potri.004G169400 [exp]	29.00	0.6513
AT5G51760		AHG1	ABA-hypersensitive germination...		Potri.015G133900 [exp]	31.46	0.6910
AT4G03540			Uncharacterised protein family...		Potri.004G043300 [exp]	37.04	0.6843
AT5G38760			Late embryogenesis abundant pr...		Potri.004G107900 [exp]	43.24	0.6801
AT2G42560			late embryogenesis abundant do...		Potri.019G090300 [exp]	45.89	0.6818

Compare expression of checked genes

Potri.011G008932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.