Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1) AT1G50720 83 / 1e-20 Stigma-specific Stig1 family protein (.1) AT4G26880 82 / 3e-20 Stigma-specific Stig1 family protein (.1) AT5G55110 71 / 7e-16 Stigma-specific Stig1 family protein (.1) AT1G53130 67 / 1e-14 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1) AT1G50650 63 / 8e-13 Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G008804 [exp] 270 / 1e-94 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 268 / 1e-93 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007000 [exp] 204 / 1e-68 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007200 [exp] 194 / 9e-64 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.004G007100 [exp] 189 / 2e-62 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.011G008932 [exp] 174 / 2e-56 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1) Potri.004G030900 [exp] 145 / 4e-45 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1) Potri.004G006800 [exp] 140 / 2e-43 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 138 / 1e-42 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020831 [exp] 102 / 3e-28 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 99 / 5e-27 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1) Lus10041930 [exp] 71 / 5e-16 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 70 / 1e-15 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 68 / 6e-15 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10005544 [exp] 64 / 9e-14 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 65 / 2e-13 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1) Lus10006512 [exp] 64 / 2e-13 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 62 / 4e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [poplar] [flax] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Potri.011G009100.2 pacid=42781125 polypeptide=Potri.011G009100.2.p locus=Potri.011G009100 ID=Potri.011G009100.2.v4.1 annot-version=v4.1 ATGAAGTTCCTTAAGCTACTCTTTCTTCTTGCTATGCTCATTTCATTTTCAGCCATCACTCTTTCTGCTACACCAACGGAAGAAGTTTCATTCCCTGATC ACTTCGATTTCGAAGACAAGGAAAACTCTGGCCATCTTCAGACTGAGAGCCAAGAAACAACTTCCTCTCTGAGAGGGACAAACCGCTTTCTAGCCCAGAC TCGGGCTTTCATGACATGTGACAAGAACCCTAGGGTTTGTCAAGTTCAGGGAAGCCCTGGTCCAGATTGCTGCAAGAAGATGTGTGTTAATCAAATGACA GACTGGTTTAACTGTGGGAAGTGTGGTAAGAAGTGTAGGTACACAGAGATCTGTTGCGAAGGGCAGTGTGTGAACCCAATGTATAGCAAGAATCATTGTG GAGGTTGCAACAACGAGTGCAAGAAAGGGAGTGTATGTCAGTATGGGATGTGTAGTTATGCATAG
AA sequence Show only first row Show all	>Potri.011G009100.2 pacid=42781125 polypeptide=Potri.011G009100.2.p locus=Potri.011G009100 ID=Potri.011G009100.2.v4.1 annot-version=v4.1 MKFLKLLFLLAMLISFSAITLSATPTEEVSFPDHFDFEDKENSGHLQTESQETTSSLRGTNRFLAQTRAFMTCDKNPRVCQVQGSPGPDCCKKMCVNQMT DWFNCGKCGKKCRYTEICCEGQCVNPMYSKNHCGGCNNECKKGSVCQYGMCSYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11925			Stigma-specific Stig1 family p...		Potri.011G009100 [exp]	0	1
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181100 [exp]	5.09	0.9901	Pt-NRAMP1.4
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	6.48	0.9898
AT4G19690		ATIRT1, IRT1	ARABIDOPSIS IRON-REGULATED TRA...		Potri.015G117900 [exp]	7.48	0.9885	Pt-ZIP6.4
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	8.94	0.9883
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006800 [exp]	10.24	0.9861
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177601 [exp]	10.58	0.9859
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177501 [exp]	11.48	0.9823
AT1G16310			Cation efflux family protein (...		Potri.008G083600 [exp]	14.14	0.9642	PtrMTP9
AT1G31260		ZIP10	zinc transporter 10 precursor ...		Potri.015G117700 [exp]	14.96	0.9786
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006901 [exp]	15.09	0.9817

Compare expression of checked genes

Potri.011G009100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.