Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56520 45 / 1e-05 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 44 / 3e-05 transmembrane receptors;ATP binding (.1.2) AT1G27180 44 / 4e-05 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G56540 44 / 5e-05 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63880 42 / 0.0001 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G17050 42 / 0.0002 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G40100 41 / 0.0003 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63750 41 / 0.0003 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT5G38350 40 / 0.0006 Disease resistance protein (NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G282700 [exp] 196 / 3e-63 AT5G44870 59 / 1e-09 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G283100 [exp] 201 / 5e-63 AT5G40100 57 / 3e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G284000 [exp] 196 / 8e-62 AT1G64070 48 / 1e-05 RESISTANCE TO LEPTOSPHAERIA MACULANS 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G283600 [exp] 194 / 1e-60 AT5G36930 140 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269900 [exp] 200 / 4e-60 AT5G36930 284 / 2e-81 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282300 [exp] 200 / 2e-59 AT5G36930 413 / 3e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G270000 [exp] 198 / 7e-59 AT5G36930 496 / 1e-155 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283700 [exp] 189 / 8e-59 AT5G40100 66 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G282800 [exp] 189 / 1e-58 AT5G40100 67 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011741 [exp] 49 / 5e-07 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10003749 [exp] 42 / 0.0002 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10038249 [exp] 40 / 0.0007 AT5G17680 445 / 4e-137 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G012851.1 pacid=42781795 polypeptide=Potri.011G012851.1.p locus=Potri.011G012851 ID=Potri.011G012851.1.v4.1 annot-version=v4.1 ATGGATTTAGAGCATCATCAGGGCCGGAGGTTGCATCAAAGTGATAGAATTGTTGCAAGCACATCTTACATTACATCTCTTCCATTGAAGCTATGCTTTC CCTCCAGGTTTTCAGAAATGAAAAATTCCAGATTTAGCTTGTTCACATTGCCACACTCTTTGACGACACTAAATTTAAGTAGAACTCCAATTTGTTTTCT TCCACCAAGCATTATGGACATTGGTACACTCAATTACCTTTCATTAGAGGAATGCAAAATGCTTCAAACACTCCTAGAGCTTCCATCCAGTTTGGTTGGG TTAGACGTGTCCTATTGTTATTCGCTGCAAAGAATTGCAAATCTGATCCCTTTTACCATAGCTCGTGATTGTGATCAATTAGTTCACATCCAAGATTGGA TTAAGCTAGAATTAATCCAAAAGGTTGACTCACACTTGTTGAGAATAATGGAAATGGTCAGCGTTCAAATGCAGACATGGAGATTTCAGATAGAACTCAG GGCAACAGATTCAATGTTGTCCTTGAATATGATGAAAATGAGATGTTGGAGTTTTATGAAGAGGAAGGGCTAA
AA sequence Show only first row Show all	>Potri.011G012851.1 pacid=42781795 polypeptide=Potri.011G012851.1.p locus=Potri.011G012851 ID=Potri.011G012851.1.v4.1 annot-version=v4.1 MDLEHHQGRRLHQSDRIVASTSYITSLPLKLCFPSRFSEMKNSRFSLFTLPHSLTTLNLSRTPICFLPPSIMDIGTLNYLSLEECKMLQTLLELPSSLVG LDVSYCYSLQRIANLIPFTIARDCDQLVHIQDWIKLELIQKVDSHLLRIMEMVSVQMQTWRFQIELRATDSMLSLNMMKMRCWSFMKRKG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41750			Disease resistance protein (TI...		Potri.011G012851 [exp]	0	1
					Potri.003G175432 [exp]	10.58	0.8482
AT5G06060			NAD(P)-binding Rossmann-fold s...		Potri.010G199700 [exp]	34.49	0.8421
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Potri.017G141000 [exp]	44.45	0.8132
AT5G36930			Disease resistance protein (TI...		Potri.011G012950 [exp]	52.99	0.8459
AT1G70650			Ran BP2/NZF zinc finger-like s...		Potri.010G107400 [exp]	57.82	0.7957
AT1G19250		FMO1	flavin-dependent monooxygenase...		Potri.009G143500 [exp]	60.73	0.7943
AT2G47430		CKI1	CYTOKININ-INDEPENDENT 1, Signa...		Potri.014G121500 [exp]	77.58	0.7946	CKI1.5
AT2G33600			NAD(P)-binding Rossmann-fold s...		Potri.002G003200 [exp]	80.37	0.8190
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G024900 [exp]	100.59	0.8261
AT1G01490			Heavy metal transport/detoxifi...		Potri.005G230300 [exp]	173.42	0.8135

Compare expression of checked genes

Potri.011G012851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.