Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72890 75 / 4e-17 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72860 72 / 8e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G09430 65 / 1e-13 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72920 64 / 1e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G40100 63 / 9e-13 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 63 / 1e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G17600 62 / 2e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72910 62 / 2e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G36930 62 / 2e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72940 62 / 2e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G283500 [exp] 147 / 3e-44 AT5G36930 235 / 8e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282300 [exp] 152 / 4e-44 AT5G36930 413 / 3e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008548 [exp] 136 / 1e-43 AT1G72890 70 / 6e-16 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Potri.011G014101 [exp] 147 / 9e-43 AT5G36930 435 / 1e-137 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G270000 [exp] 147 / 1e-42 AT5G36930 496 / 1e-155 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282600 [exp] 147 / 2e-42 AT5G36930 466 / 1e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283000 [exp] 142 / 7e-41 AT5G36930 460 / 8e-143 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013700 [exp] 142 / 7e-41 AT5G36930 378 / 3e-117 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282200 [exp] 142 / 7e-41 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011741 [exp] 85 / 2e-20 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 79 / 2e-18 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10007811 [exp] 75 / 5e-17 AT5G36930 376 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10032101 [exp] 75 / 6e-17 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10014582 [exp] 74 / 1e-16 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10004719 [exp] 71 / 1e-15 AT5G36930 384 / 3e-113 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015453 [exp] 71 / 2e-15 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10000153 [exp] 69 / 2e-15 AT5G36930 134 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041060 [exp] 70 / 3e-15 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 70 / 3e-15 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.011G013225.1 pacid=42782137 polypeptide=Potri.011G013225.1.p locus=Potri.011G013225 ID=Potri.011G013225.1.v4.1 annot-version=v4.1 ATGAACACTTCAGCTTATTGGTGTGCTGTCAATCTTGAAAACTGTTTTATTTTGTTCAGATCTTTGAAAAGTCTTATCTTTGCTAGACTCGAAATGGCTG CTGGGAAATATCAAGAATCCTACTCTTCACGGTTTTCTTATTGTAAATATCAAGTGTTCTTGAGTTTTAGAGGTGAAGACACCCGCAAGAACTTTACCGA TCACCTCTACAAGGCCCTGGTTGATGCAGGGTTTCACACATTTAGAGATGATGATGAAATTCGGAGAGGAAAGAATATACAGCTGGAGCTCCAGAAGGCA ATACAACAATAA
AA sequence Show only first row Show all	>Potri.011G013225.1 pacid=42782137 polypeptide=Potri.011G013225.1.p locus=Potri.011G013225 ID=Potri.011G013225.1.v4.1 annot-version=v4.1 MNTSAYWCAVNLENCFILFRSLKSLIFARLEMAAGKYQESYSSRFSYCKYQVFLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDEIRRGKNIQLELQKA IQQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G72890			Disease resistance protein (TI...		Potri.011G013225 [exp]	0	1
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	1.73	0.9368
AT4G27290			S-locus lectin protein kinase ...		Potri.010G015533 [exp]	4.89	0.7216
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.009G017600 [exp]	7.07	0.8216
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	8.48	0.8296
					Potri.005G255601 [exp]	10.09	0.7028
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	10.24	0.8116
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	10.67	0.8189
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	12.32	0.8102
					Potri.005G187000 [exp]	13.41	0.7820
					Potri.010G080633 [exp]	13.74	0.7887

Compare expression of checked genes

Potri.011G013225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.