Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 134 / 2e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27170 105 / 2e-25 transmembrane receptors;ATP binding (.1.2) AT1G27180 99 / 2e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G19510 86 / 6e-19 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT5G46260 82 / 1e-17 disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46270 81 / 3e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45260 81 / 4e-17 WRKY ATWRKY52, SLH1, RRS1 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT5G22690 80 / 1e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46490 79 / 1e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72840 79 / 2e-16 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G013700 [exp] 523 / 0 AT5G36930 378 / 3e-117 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269900 [exp] 497 / 1e-172 AT5G36930 284 / 2e-81 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G014101 [exp] 494 / 1e-172 AT5G36930 435 / 1e-137 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282200 [exp] 503 / 1e-171 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013900 [exp] 503 / 2e-171 AT5G36930 441 / 1e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283000 [exp] 501 / 5e-171 AT5G36930 460 / 8e-143 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013450 [exp] 498 / 7e-171 AT5G36930 422 / 2e-129 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G011600 [exp] 499 / 3e-170 AT5G36930 492 / 1e-154 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G015400 [exp] 498 / 1e-169 AT5G36930 438 / 1e-134 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 175 / 2e-49 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10033825 [exp] 170 / 6e-48 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011741 [exp] 162 / 4e-45 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 129 / 8e-34 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 122 / 3e-31 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030345 [exp] 98 / 7e-23 AT5G17680 528 / 5e-168 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041078 [exp] 97 / 2e-22 AT5G17680 399 / 6e-126 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10003749 [exp] 96 / 3e-22 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10024886 [exp] 94 / 3e-21 AT5G36930 370 / 1e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018972 [exp] 92 / 5e-21 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G014301.1 pacid=42781477 polypeptide=Potri.011G014301.1.p locus=Potri.011G014301 ID=Potri.011G014301.1.v4.1 annot-version=v4.1 ATGGAAGTGATTCCTAATTTTGAAGTTCAAAAGGTTCTTCGAATAAGTTACGACTTTCTTGATGGTGATTATCCGAAGATCTTATTCCTTGATATCACAT GTTTCTTCAATGGAATGGATGTGGATGATGCAGTTAGGATACTGGATGGGCTCGATAAAGGTGCAAGATTTGGGATTGACAATCTCATCGATAGATGTCT TGTTGAAATCAACAATGATCAAAGGTTGTGGATGCATCAACTAGTAATAGATATGGGAAGGGAAATTGCTCGTCAAGAATCACCCAAATGTCAAAGAATA TGGCATCAAGGGGATGCTTTTACAGTTTTGAAAGGAACTACTGATGCTGAAAAATTGCGTGGCCTTACCATTGATATGCATGCATTAATGGAATATCATT ATGCAGAAGTTGTCTGTACTGATTCAATGGTTTGTCGCAAGCGCCGCAGGCTTAACTTCTTTCAACAATGGCTTTCCGATTTTTTCGATGGGGGAAAATT ACAAACTGGCCAAACAAGTTTGTTTCCCATCCTCAACACGGATGCTTTTAGAAAGATGCCAGATGTAAAATTTCTCCAACTAAACTACACTAATTTTCAT GGAAGTTTTGAGCACTTTCCCAAGAATTTGATATGGTTATGTTGGCATGGATTGTCTTGGAGCTCCATACCAAATCACGTATGCTTGGAGAAGCTGGTGG TTCTTGATCTATCCAGAAGTTGTCTAGTTGATGCTTGGAAGGGCAAACCGAACCCCAGACTTCTCGGGTCTCCCAGCCCTTGA
AA sequence Show only first row Show all	>Potri.011G014301.1 pacid=42781477 polypeptide=Potri.011G014301.1.p locus=Potri.011G014301 ID=Potri.011G014301.1.v4.1 annot-version=v4.1 MEVIPNFEVQKVLRISYDFLDGDYPKILFLDITCFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVIDMGREIARQESPKCQRI WHQGDAFTVLKGTTDAEKLRGLTIDMHALMEYHYAEVVCTDSMVCRKRRRLNFFQQWLSDFFDGGKLQTGQTSLFPILNTDAFRKMPDVKFLQLNYTNFH GSFEHFPKNLIWLCWHGLSWSSIPNHVCLEKLVVLDLSRSCLVDAWKGKPNPRLLGSPSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.011G014301 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.011G015050 [exp]	2.82	0.9717
AT4G27220			NB-ARC domain-containing disea...		Potri.019G020102 [exp]	3.16	0.9773
AT5G36930			Disease resistance protein (TI...		Potri.006G282300 [exp]	6.63	0.9597
AT5G36930			Disease resistance protein (TI...		Potri.011G008164 [exp]	6.92	0.9686
AT5G17680			disease resistance protein (TI...		Potri.019G070651 [exp]	8.24	0.9533
AT5G36930			Disease resistance protein (TI...		Potri.011G009251 [exp]	10.19	0.9581
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	10.95	0.9626
AT5G36930			Disease resistance protein (TI...		Potri.011G008228 [exp]	17.32	0.9350
AT5G17680			disease resistance protein (TI...		Potri.019G070565 [exp]	18.33	0.9323
AT5G17680			disease resistance protein (TI...		Potri.013G097000 [exp]	18.73	0.9323

Compare expression of checked genes

Potri.011G014301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.