Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14370 59 / 7e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63870 56 / 7e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G11250 54 / 5e-09 Disease resistance protein (TIR-NBS-LRR class) (.1) AT5G49140 54 / 7e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G12010 53 / 1e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G64070 52 / 2e-08 RLM1 RESISTANCE TO LEPTOSPHAERIA MACULANS 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G56520 52 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G38850 52 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) (.1) AT4G36150 52 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40100 51 / 5e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G282700 [exp] 233 / 1e-78 AT5G44870 59 / 1e-09 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.011G015400 [exp] 248 / 2e-77 AT5G36930 438 / 1e-134 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G077260 [exp] 243 / 2e-77 AT5G36930 195 / 8e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283700 [exp] 232 / 2e-76 AT5G40100 66 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G283600 [exp] 233 / 4e-76 AT5G36930 140 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282800 [exp] 231 / 5e-76 AT5G40100 67 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.011G012750 [exp] 238 / 8e-76 AT5G36930 195 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008612 [exp] 242 / 4e-75 AT5G36930 467 / 6e-145 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013450 [exp] 239 / 2e-74 AT5G36930 422 / 2e-129 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003749 [exp] 52 / 3e-08 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10028043 [exp] 51 / 5e-08 AT5G17680 59 / 4e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10004075 [exp] 49 / 2e-07 AT4G12010 348 / 3e-102 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029722 [exp] 48 / 5e-07 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10039850 [exp] 45 / 5e-06 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015350 [exp] 44 / 2e-05 AT4G12010 422 / 2e-127 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015649 [exp] 43 / 2e-05 AT1G69550 75 / 1e-15 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10001375 [exp] 43 / 4e-05 AT5G36930 464 / 3e-141 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015648 [exp] 42 / 7e-05 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042753 [exp] 42 / 7e-05 AT4G12010 121 / 3e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G014501.1 pacid=42782410 polypeptide=Potri.011G014501.1.p locus=Potri.011G014501 ID=Potri.011G014501.1.v4.1 annot-version=v4.1 ATGGAGCTTCCAGAAGAAATGAGTAGATTGAATTCACTTCAGGAGCTGGTTTTAGATGGTTGCTCAAATCTTGACAGCCTGAATATGGAGTTAGAGCATC ATCAGGGGCGCAAGTTGCTTCAAAGTGATGAAATTGTTGCAAGTACATCATTCATTACATCTCTTCCATTGAAGCTATTCTTTCCCTCTAGGTTTTCAAC GAGGAAAATGTTGAGATTTACCTCGTTTGCACTGCCAGGCTCCTTGACGAGACTAGATTTAAGTGGAATAACAATGCGTTCTTTTCCAGAAAGCATCAAG GATCTTGGTCTACTCGATTTCCTATATTTAAGAAATTGCAAAATGCTTCAGGCAGTCCCAGAGCTTCCATCCCATTTGCGGCTGTTAGATGTGTCCTTTT GCTATTCACTGCAAAGACTTGCAAATCTAACCGTTTGGACTTAA
AA sequence Show only first row Show all	>Potri.011G014501.1 pacid=42782410 polypeptide=Potri.011G014501.1.p locus=Potri.011G014501 ID=Potri.011G014501.1.v4.1 annot-version=v4.1 MELPEEMSRLNSLQELVLDGCSNLDSLNMELEHHQGRKLLQSDEIVASTSFITSLPLKLFFPSRFSTRKMLRFTSFALPGSLTRLDLSGITMRSFPESIK DLGLLDFLYLRNCKMLQAVPELPSHLRLLDVSFCYSLQRLANLTVWT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14370			Disease resistance protein (TI...		Potri.011G014501 [exp]	0	1
AT2G01350		QPT	quinolinate phoshoribosyltrans...		Potri.010G113500 [exp]	6.00	0.8664
AT1G22970			unknown protein		Potri.010G117100 [exp]	7.74	0.8823
					Potri.004G170442 [exp]	11.74	0.8728
AT3G14470			NB-ARC domain-containing disea...		Potri.003G200500 [exp]	14.49	0.8670
AT1G67080		ABA4	abscisic acid (aba)-deficient ...		Potri.017G114900 [exp]	17.14	0.8063
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.006G269800 [exp]	18.43	0.8488
AT4G02550			unknown protein		Potri.009G022650 [exp]	20.78	0.8571
AT3G62470			Pentatricopeptide repeat (PPR)...		Potri.008G191200 [exp]	21.02	0.8227
AT4G02550			unknown protein		Potri.006G146100 [exp]	22.00	0.8314
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.009G048200 [exp]	23.00	0.8305

Compare expression of checked genes

Potri.011G014501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.