Potri.011G014701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G012000 275 / 4e-86 AT5G36930 489 / 2e-153 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G077260 263 / 4e-84 AT5G36930 195 / 8e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G012475 268 / 2e-83 AT5G36930 431 / 1e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G013450 261 / 1e-81 AT5G36930 422 / 2e-129 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G008164 260 / 7e-81 AT5G36930 491 / 3e-154 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G012750 246 / 8e-78 AT5G36930 195 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G008292 247 / 4e-76 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.006G270000 245 / 3e-75 AT5G36930 496 / 1e-155 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.011G009251 243 / 1e-74 AT5G36930 508 / 1e-160 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G014701.1 pacid=42780746 polypeptide=Potri.011G014701.1.p locus=Potri.011G014701 ID=Potri.011G014701.1.v4.1 annot-version=v4.1
ATGGAAACGGTTAGTGCTCAAATACAGCCATCGATATTTAAGATAATATTTATGGATGGCATATTCAACTTTGTCGTATGTGTACTTGATGAAGATGAGA
TGTTAAGGTGGTTTCATGAGAAGAAAGAAGAGGATAAATGGCTAGTTCAGAATGAGTTTACAGAGAAATTTTCATTCAAAATATCCTCACCTGGGACGCA
CCAGATATGTGGCCTTAATCTGTTCACAAGGTTTTGTGTGACGTCAGAGTACAGTTTCTATGATGCTTTTCATATTGAAATCAGAAACAATACCAGTGGT
CTATCCATGCATTGTCAAGCCTATCTCCTCCCTACTCGTTACAAGCGTGGGCCGGTTCGTGAAATCCAATCGCTAAAGCACGGGAAATTAGGGGTCGGTG
ATCCTACATTTGATGATGGTGATGACGTGAGTATTTCAGTGCTTCCACATGATCTAGCTATTCAAGTAAAGGCGATTGGTGTACAGTGGTTGCATGAAGA
GGAAAGAAAGGATGATGATATCCTATCAAAGGATGATGTTATCAATGCCCACAACAGTAGCGATGATGATGAAGATGCAGCACACGTAGCCAAGTAG
AA sequence
>Potri.011G014701.1 pacid=42780746 polypeptide=Potri.011G014701.1.p locus=Potri.011G014701 ID=Potri.011G014701.1.v4.1 annot-version=v4.1
METVSAQIQPSIFKIIFMDGIFNFVVCVLDEDEMLRWFHEKKEEDKWLVQNEFTEKFSFKISSPGTHQICGLNLFTRFCVTSEYSFYDAFHIEIRNNTSG
LSMHCQAYLLPTRYKRGPVREIQSLKHGKLGVGDPTFDDGDDVSISVLPHDLAIQVKAIGVQWLHEEERKDDDILSKDDVINAHNSSDDDEDAAHVAK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G014701 0 1
AT3G42170 BED zinc finger ;hAT family di... Potri.017G019466 7.93 0.8964
AT5G36930 Disease resistance protein (TI... Potri.011G008228 12.72 0.8943
AT4G14210 PDE226, PDS3 PIGMENT DEFECTIVE 226, phytoen... Potri.002G235200 14.69 0.8796 PDS.2
Potri.005G239150 17.02 0.7520
AT1G61415 unknown protein Potri.015G049800 17.32 0.8470
AT2G25770 Polyketide cyclase/dehydrase a... Potri.018G046100 25.03 0.8681
AT5G05800 unknown protein Potri.001G243108 30.16 0.8709
AT4G26090 RPS2 RESISTANT TO P. SYRINGAE 2, NB... Potri.001G435000 36.00 0.8678
AT3G06080 TBL10 TRICHOME BIREFRINGENCE-LIKE 10... Potri.005G208301 41.13 0.8579
AT4G25170 Uncharacterised conserved prot... Potri.001G126300 41.24 0.8475

Potri.011G014701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.