Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 112 / 7e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72860 106 / 5e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72890 98 / 3e-24 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72900 92 / 2e-22 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G09430 91 / 1e-21 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40100 91 / 1e-21 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72920 89 / 1e-21 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72930 86 / 2e-21 TIR toll/interleukin-1 receptor-like (.1.2) AT5G17680 90 / 3e-21 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G27170 90 / 4e-21 transmembrane receptors;ATP binding (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G269950 [exp] 251 / 1e-85 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283500 [exp] 250 / 3e-83 AT5G36930 235 / 8e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G014101 [exp] 258 / 1e-82 AT5G36930 435 / 1e-137 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008228 [exp] 258 / 2e-81 AT5G36930 468 / 3e-148 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013700 [exp] 252 / 8e-81 AT5G36930 378 / 3e-117 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008868 [exp] 259 / 1e-80 AT5G36930 471 / 1e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008292 [exp] 258 / 2e-80 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008612 [exp] 256 / 1e-79 AT5G36930 467 / 6e-145 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012475 [exp] 254 / 5e-79 AT5G36930 431 / 1e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011741 [exp] 134 / 9e-37 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018972 [exp] 134 / 2e-36 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 127 / 4e-34 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 108 / 1e-27 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 107 / 4e-27 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 103 / 9e-26 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 102 / 3e-25 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10019708 [exp] 100 / 1e-24 AT5G17680 495 / 1e-150 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 100 / 1e-24 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007808 [exp] 96 / 2e-23 AT5G36930 418 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.011G015050.1 pacid=42781051 polypeptide=Potri.011G015050.1.p locus=Potri.011G015050 ID=Potri.011G015050.1.v4.1 annot-version=v4.1 ATGGCTCCTGGGAAATATCAAGAATCCTACTCTTCCCGGTTTTCTAATTATAAATATCAAGTGTTCTTGAGTTTTAGAGGTGAAGACACCCATAAGAACT TGACCGATCACCTCTACAAGGCCCTGGTTGATGCAGGGATTCACACATTTAGAGATGATGATGAAATTCAGAGAGGAGAGAATATATATTTCGAGCTCCA GAAGGCAATACAACAATCGAAAATATCGATAATCGTGTTCTCCAAAGACTATGCTTCGTCGAGATGGTGCCTCGATGAACTTGTAATGATCATGGAACGG AGCTTTGCTGCTGCATTTGTGGAACATGAAAAGCATTACAAGGAGAAGATGGAGCGGGTGAAGGGGTGGGGGATTGCTTTGAAGGAAGTTGCAGATTTAG CTGGAATGGATTTAGGAGATGGGTACGAGGCACAGTTTGTCCAATCTATTGTGGAGAAGGTCTCAAAGAAATTGGATAAAAAAATGTTTCATGTACCCTT CATTTCATTGGAAGAGATCCTCTAG
AA sequence Show only first row Show all	>Potri.011G015050.1 pacid=42781051 polypeptide=Potri.011G015050.1.p locus=Potri.011G015050 ID=Potri.011G015050.1.v4.1 annot-version=v4.1 MAPGKYQESYSSRFSNYKYQVFLSFRGEDTHKNLTDHLYKALVDAGIHTFRDDDEIQRGENIYFELQKAIQQSKISIIVFSKDYASSRWCLDELVMIMER SFAAAFVEHEKHYKEKMERVKGWGIALKEVADLAGMDLGDGYEAQFVQSIVEKVSKKLDKKMFHVPFISLEEIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.011G015050 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.011G014301 [exp]	2.82	0.9717
AT3G14470			NB-ARC domain-containing disea...		Potri.012G122200 [exp]	6.70	0.9456
AT4G27220			NB-ARC domain-containing disea...		Potri.019G020102 [exp]	8.00	0.9625
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Potri.004G230100 [exp]	9.27	0.9314
AT5G36930			Disease resistance protein (TI...		Potri.011G008164 [exp]	10.90	0.9537
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	10.95	0.9588
AT5G01750			Protein of unknown function (D...		Potri.016G131500 [exp]	14.49	0.9366
AT3G14470			NB-ARC domain-containing disea...		Potri.012G123000 [exp]	14.49	0.9341
AT5G17680			disease resistance protein (TI...		Potri.019G070565 [exp]	14.96	0.9356
AT5G22355			Cysteine/Histidine-rich C1 dom...		Potri.016G044800 [exp]	20.78	0.9104

Compare expression of checked genes

Potri.011G015050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.