Potri.011G021332 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G45616 79 / 4e-16 AtRLP6 receptor like protein 6 (.1)
AT3G05660 76 / 4e-15 AtRLP33 receptor like protein 33 (.1)
AT3G05650 74 / 1e-14 AtRLP32 receptor like protein 32 (.1)
AT1G47890 74 / 1e-14 AtRLP7 receptor like protein 7 (.1)
AT3G28890 74 / 2e-14 AtRLP43 receptor like protein 43 (.1.2)
AT5G27060 74 / 2e-14 AtRLP53 receptor like protein 53 (.1)
AT3G11010 64 / 2e-11 AtRLP34 receptor like protein 34 (.1)
AT1G71400 64 / 4e-11 AtRLP12 receptor like protein 12 (.1)
AT5G56040 63 / 5e-11 Leucine-rich receptor-like protein kinase family protein (.1.2)
AT3G05370 63 / 6e-11 AtRLP31 receptor like protein 31 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G021400 412 / 4e-137 AT3G11080 375 / 2e-114 receptor like protein 35 (.1)
Potri.016G120600 119 / 4e-30 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.016G126900 106 / 1e-25 AT1G45616 510 / 5e-165 receptor like protein 6 (.1)
Potri.016G127101 100 / 3e-23 AT1G47890 580 / 0.0 receptor like protein 7 (.1)
Potri.016G127000 96 / 6e-22 AT1G47890 588 / 0.0 receptor like protein 7 (.1)
Potri.001G128400 87 / 8e-19 AT1G45616 498 / 2e-159 receptor like protein 6 (.1)
Potri.001G437700 85 / 3e-18 AT1G47890 397 / 4e-122 receptor like protein 7 (.1)
Potri.016G120532 82 / 3e-17 AT1G45616 325 / 9e-98 receptor like protein 6 (.1)
Potri.T125004 70 / 3e-13 AT1G45616 384 / 9e-117 receptor like protein 6 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009330 131 / 4e-34 AT1G71400 245 / 2e-69 receptor like protein 12 (.1)
Lus10002215 119 / 3e-30 AT4G20140 202 / 7e-56 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Lus10003387 115 / 1e-28 AT1G47890 394 / 3e-120 receptor like protein 7 (.1)
Lus10003389 114 / 2e-28 AT1G45616 432 / 7e-135 receptor like protein 6 (.1)
Lus10026415 108 / 2e-26 AT1G47890 424 / 3e-131 receptor like protein 7 (.1)
Lus10042239 108 / 5e-26 AT1G45616 395 / 1e-121 receptor like protein 6 (.1)
Lus10002212 105 / 3e-25 AT5G01300 226 / 4e-70 PEBP (phosphatidylethanolamine-binding protein) family protein (.1), PEBP (phosphatidylethanolamine-binding protein) family protein (.2)
Lus10011039 89 / 1e-19 AT3G11010 367 / 5e-110 receptor like protein 34 (.1)
Lus10000228 85 / 2e-18 AT3G05370 231 / 3e-66 receptor like protein 31 (.1)
Lus10027580 82 / 3e-17 AT5G62230 194 / 4e-53 ERECTA-like 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
CL0022 LRR PF13855 LRR_8 Leucine rich repeat
Representative CDS sequence
>Potri.011G021332.1 pacid=42782136 polypeptide=Potri.011G021332.1.p locus=Potri.011G021332 ID=Potri.011G021332.1.v4.1 annot-version=v4.1
ATGAGAGATTTTCATCATCGTTTACTCTTGTTTCTTTACTTGTTCCTACTCTCTTTGTATCAAGCAAGTATCGCTTCATCTCTGTCAACAGCAACAAAAG
CTGCCCACCACCGATGCCGCGATGACCAGAGATCGGCCTTCGCGCAGCTGCAAGAGAACCTTAAATTCCCAGTATCATCTTCAAAAGCTGAGTTGTGGGA
CCTGAAAACAGATTGTTGCTCTTGGGAAGGAGTTGCATGTAATGATGTTGGTCATGCCACTCGACTTGACCTGAGTTCTGCGTATGATGAATATGGAGAT
TCTATTTCACTCAAAAAGCCAAACCTTGGAATGCTTTTCCAGAATCTCAGTTTTCTAGTAGAGCTCAATCTTGATTATGTAAACATTTCAGCACAAGGTA
GCAATTGGTGTGAAGTCATCTCCCATGTGCTTCCCAACCTTAGAGTCTTGAGTTTGTCTGGCTCTGGTCTTTCTGGTCCTCTTTGTTCCTCTCTCTCAAA
ACTCCATTTTCTCTCCAAACTCGATCTTCATAGCAATTCCGAACTCTCTTCCATTCCACCCAGTTTCTTAGCAAATTCCTTCAACTTGGAAACTCTTGAC
TTATCATATTGTGGCTTGAACGGGAGCTTTCCAAACAACATTTTCCTATTGCCAAAACTACAGTACATTGATCTCTCTGAAAATTTACTCCTTCCAGGTC
AGTTTCCAGACTTCTCATTGAATAGTTCTATTCAATACTTGTCACTCAAGAGCACAAGCTTTTCTGGGAACATCCCACTGTCAATCAGCAATCTCAAGTC
CTTGAATTATCTAGACCTGAGCAGGTGCAAATTTTATGGAGTTATCCCAGTTTAA
AA sequence
>Potri.011G021332.1 pacid=42782136 polypeptide=Potri.011G021332.1.p locus=Potri.011G021332 ID=Potri.011G021332.1.v4.1 annot-version=v4.1
MRDFHHRLLLFLYLFLLSLYQASIASSLSTATKAAHHRCRDDQRSAFAQLQENLKFPVSSSKAELWDLKTDCCSWEGVACNDVGHATRLDLSSAYDEYGD
SISLKKPNLGMLFQNLSFLVELNLDYVNISAQGSNWCEVISHVLPNLRVLSLSGSGLSGPLCSSLSKLHFLSKLDLHSNSELSSIPPSFLANSFNLETLD
LSYCGLNGSFPNNIFLLPKLQYIDLSENLLLPGQFPDFSLNSSIQYLSLKSTSFSGNIPLSISNLKSLNYLDLSRCKFYGVIPV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.011G021332 0 1
AT1G19920 ASA1, APS2 ATP SULFURYLASE ARABIDOPSIS 1,... Potri.005G237300 2.44 0.9625
AT1G64500 Glutaredoxin family protein (.... Potri.003G141800 3.87 0.9675
AT5G23530 ATCXE18 carboxyesterase 18 (.1) Potri.019G014306 4.24 0.9625
AT5G25840 Protein of unknown function (D... Potri.003G050200 4.47 0.9488
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Potri.002G168600 7.48 0.9515
AT1G75100 JAC1 J-domain protein required for ... Potri.002G134300 8.48 0.9472
AT3G52740 unknown protein Potri.004G202900 8.94 0.9544
Potri.015G143150 9.94 0.9482
AT1G07010 AtSLP1 Shewenella-like protein phosph... Potri.009G077900 10.39 0.9533
AT1G75460 ATP-dependent protease La (LON... Potri.005G232800 10.81 0.9461

Potri.011G021332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.