Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08770 60 / 8e-13 LTP6 lipid transfer protein 6 (.1.2) AT3G51590 60 / 1e-12 LTP12 lipid transfer protein 12 (.1) AT2G15325 59 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38530 59 / 5e-12 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G18370 58 / 7e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 56 / 4e-11 LTP5 lipid transfer protein 5 (.1) AT5G59310 56 / 4e-11 LTP4 lipid transfer protein 4 (.1) AT4G33355 56 / 6e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G59320 51 / 3e-09 LTP3 lipid transfer protein 3 (.1) AT5G01870 49 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G022150 [exp] 99 / 4e-28 AT3G51590 54 / 2e-10 lipid transfer protein 12 (.1) Potri.016G135700 [exp] 74 / 3e-18 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232900 [exp] 66 / 8e-15 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 65 / 1e-14 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 64 / 3e-14 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.009G025200 [exp] 62 / 2e-13 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 61 / 4e-13 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.014G098000 [exp] 56 / 5e-11 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.004G086600 [exp] 56 / 5e-11 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012383 [exp] 97 / 6e-27 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10028055 [exp] 97 / 6e-27 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10012384 [exp] 94 / 4e-26 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10028002 [exp] 94 / 7e-26 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028003 [exp] 94 / 7e-26 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10001703 [exp] 62 / 3e-13 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001829 [exp] 62 / 4e-13 AT4G33355 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10029445 [exp] 58 / 1e-11 AT4G33355 103 / 2e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10012392 [exp] 58 / 1e-11 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10025230 [exp] 58 / 2e-11 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.011G021900.2 pacid=42780531 polypeptide=Potri.011G021900.2.p locus=Potri.011G021900 ID=Potri.011G021900.2.v4.1 annot-version=v4.1 ATGGAGAAGAAAATAGTGGTGGCTGTGATTGCTTTTTGGCTAACGCTTTCTTTTGGGAGTGGAAGCACAAGCGTGGCTAACGACATTTGCACAGAAGCCA TGACTAGGTTGCGCAACTGCCTCCCATTCTTGACTACTACTGCCCCATCACCATCTCTTTCTTGCTGCGAAGCTGTGGGATGGGTGAGTCAACATGCTAC CACCACACAAGACCGTAGGGACCTCTGTAAATGCTTAAAGAGCGCATCTCTTGCTTACAAGGTTGATCCTACCAGAGCTAAGGAACTTCCTGATGTGTGC AAAGTCTCTGTCCCCGTGCCCATCTTACCCCAAATCGACTGTGACAAGATCCAGTAG
AA sequence Show only first row Show all	>Potri.011G021900.2 pacid=42780531 polypeptide=Potri.011G021900.2.p locus=Potri.011G021900 ID=Potri.011G021900.2.v4.1 annot-version=v4.1 MEKKIVVAVIAFWLTLSFGSGSTSVANDICTEAMTRLRNCLPFLTTTAPSPSLSCCEAVGWVSQHATTTQDRRDLCKCLKSASLAYKVDPTRAKELPDVC KVSVPVPILPQIDCDKIQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G08770		LTP6	lipid transfer protein 6 (.1.2...		Potri.011G021900 [exp]	0	1
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Potri.006G160700 [exp]	8.71	0.8186
AT5G66520			Tetratricopeptide repeat (TPR)...		Potri.006G231200 [exp]	13.85	0.7126
AT1G30760			FAD-binding Berberine family p...		Potri.011G161500 [exp]	14.07	0.8140
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.001G468900 [exp]	20.14	0.7790
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.002G078600 [exp]	23.57	0.8130	ACO1
					Potri.019G062666 [exp]	26.53	0.7827
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Potri.004G181800 [exp]	29.93	0.7756
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Potri.015G013300 [exp]	32.61	0.7922
AT3G57450			unknown protein		Potri.012G032500 [exp]	33.27	0.7886
AT1G67330			Protein of unknown function (D...		Potri.001G056300 [exp]	34.29	0.7900

Compare expression of checked genes

Potri.011G021900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.