Plant FIBer expression Database

Potri.011G024500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68680 92 / 3e-26 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043296
[exp]
56 / 3e-11 AT1G68680 83 / 2e-21 unknown protein
PFAM info
Representative CDS sequence
>Potri.011G024500.2 pacid=42781969 polypeptide=Potri.011G024500.2.p locus=Potri.011G024500 ID=Potri.011G024500.2.v4.1 annot-version=v4.1
ATGGCTTCACCGTCTGATCCCACCAACCCGGAGGCGGCAGCAGCGATTAGAAGGAAAAAAAATGGACCCCCGATCAAGTTCTTGGTTCCTCTTGTCTATG
CTCCTGTTCTTCCTCTAATTCGACTCACCCTGCGTAAGAATCCTGTTGTAAGGGACCGTCTTTTCACGGCTGTCTTGGTTGGTGCTTTTGCTCATGGCTT
TTACTTGGTAACAGATATATATGACAGCGAAAGTAAGTGA
AA sequence
>Potri.011G024500.2 pacid=42781969 polypeptide=Potri.011G024500.2.p locus=Potri.011G024500 ID=Potri.011G024500.2.v4.1 annot-version=v4.1
MASPSDPTNPEAAAAIRRKKNGPPIKFLVPLVYAPVLPLIRLTLRKNPVVRDRLFTAVLVGAFAHGFYLVTDIYDSESK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G68680 unknown protein Potri.011G024500
[exp]
0 1
AT5G12250 TUB6 beta-6 tubulin (.1) Potri.009G067100
[exp]
4.00 0.9453
AT1G26940 Cyclophilin-like peptidyl-prol... Potri.010G012900
[exp]
5.09 0.9437
AT2G35120 Single hybrid motif superfamil... Potri.015G122500
[exp]
6.32 0.9382
AT4G12650 Endomembrane protein 70 protei... Potri.002G217300
[exp]
7.14 0.9414
AT4G02080 ASAR1, ATSARA1C... secretion-associated RAS super... Potri.010G141900
[exp]
10.67 0.9365 Pt-SAR1.2
AT5G37310 Endomembrane protein 70 protei... Potri.004G075450
[exp]
13.11 0.9395
AT5G11960 Protein of unknown function (D... Potri.018G060500
[exp]
16.73 0.9338
AT1G51650 ATP synthase epsilon chain, mi... Potri.008G008900
[exp]
19.44 0.9077
AT2G39630 Nucleotide-diphospho-sugar tra... Potri.010G204000
[exp]
21.56 0.9265
AT2G34250 SecY protein transport family ... Potri.011G107900
[exp]
21.67 0.8662

Potri.011G024500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.