Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11570 172 / 4e-56 NTL NTF2-like (.1.2) AT1G27970 162 / 2e-52 NTF2B nuclear transport factor 2B (.1.2) AT1G27310 150 / 7e-48 NTF2A nuclear transport factor 2A (.1) AT5G48650 63 / 3e-12 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT5G60980 57 / 3e-10 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G25150 57 / 5e-10 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G13730 56 / 1e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170800 [exp] 162 / 2e-52 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2) Potri.001G057500 [exp] 158 / 9e-51 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2) Potri.008G096700 [exp] 62 / 1e-11 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.017G094600 [exp] 60 / 4e-11 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G157800 [exp] 59 / 6e-11 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.015G058700 [exp] 56 / 1e-09 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 54 / 6e-09 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 39 / 0.001 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020061 [exp] 193 / 2e-64 AT1G11570 171 / 3e-56 NTF2-like (.1.2) Lus10037033 [exp] 160 / 2e-51 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2) Lus10032033 [exp] 157 / 2e-50 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2) Lus10006762 [exp] 149 / 1e-47 AT1G11570 130 / 2e-40 NTF2-like (.1.2) Lus10015772 [exp] 126 / 5e-38 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1) Lus10035202 [exp] 124 / 2e-37 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1) Lus10036918 [exp] 63 / 3e-12 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10026668 [exp] 62 / 7e-12 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10004644 [exp] 60 / 4e-11 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10037066 [exp] 59 / 9e-11 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [poplar] [flax] NTF2 PF02136 [poplar] [flax] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Potri.011G025500.1 pacid=42781527 polypeptide=Potri.011G025500.1.p locus=Potri.011G025500 ID=Potri.011G025500.1.v4.1 annot-version=v4.1 ATGGCATGGCCTGTTGGTGGCGGAGAAGGGAATCACTTCAATACGGAGATGGAGAGGTGCCATGTGCAAGAACAGGTTGAAGTGGTGGGGAAGGCATTTG TGGATCATTACTACAACCTTTTCGACAATGATCGATCCTCTCTTGCTTCTCTTTACCAGCCTACCTCCATGCTGACATTTGAGGGTCAGAAGATAGTTGG CGTTGAGGATATCTCCTGTAAGCTAAACAACTTGCCATTTGGTAACTGCAAACATATAATTAGCACCATTGATTCACAGCCCTCAGCTCATGGAGGGGGC ATCGTCGTGTTTGTCAGTGGCAGCCTCCAGTTGCCTGGAGAGGAGCATCACCTGAGATTTAGCCAGATGTTTCACTTGATTCCAACACAAGATGGATGCT TCTTCGTGCAAAATGACTTTTTCCGGCTAAATTATGGTTGA
AA sequence Show only first row Show all	>Potri.011G025500.1 pacid=42781527 polypeptide=Potri.011G025500.1.p locus=Potri.011G025500 ID=Potri.011G025500.1.v4.1 annot-version=v4.1 MAWPVGGGEGNHFNTEMERCHVQEQVEVVGKAFVDHYYNLFDNDRSSLASLYQPTSMLTFEGQKIVGVEDISCKLNNLPFGNCKHIISTIDSQPSAHGGG IVVFVSGSLQLPGEEHHLRFSQMFHLIPTQDGCFFVQNDFFRLNYG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11570		NTL	NTF2-like (.1.2)		Potri.011G025500 [exp]	0	1
AT1G54400			HSP20-like chaperones superfam...		Potri.013G054800 [exp]	5.65	0.9445
AT2G27140			HSP20-like chaperones superfam...		Potri.004G191200 [exp]	8.12	0.9381
AT4G33490			Eukaryotic aspartyl protease f...		Potri.007G099200 [exp]	9.32	0.9368
AT2G27140			HSP20-like chaperones superfam...		Potri.004G191101 [exp]	12.00	0.9350
AT4G03500			Ankyrin repeat family protein ...		Potri.011G016100 [exp]	14.07	0.9307
AT3G17380			TRAF-like family protein (.1)		Potri.003G103200 [exp]	16.73	0.9279
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Potri.005G112200 [exp]	16.97	0.9257
AT2G27140			HSP20-like chaperones superfam...		Potri.009G153200 [exp]	18.49	0.9257
AT5G37180		ATSUS5, SUS5	ARABIDOPSIS THALIANA SUCROSE S...		Potri.017G139100 [exp]	19.23	0.9246
AT4G39810			Polynucleotidyl transferase, r...		Potri.007G088500 [exp]	19.28	0.9213

Compare expression of checked genes

Potri.011G025500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.