Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11545 375 / 8e-133 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1) AT4G03210 233 / 3e-77 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) AT5G13870 231 / 4e-76 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) AT2G06850 229 / 4e-75 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1) AT4G37800 224 / 2e-73 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1) AT5G65730 221 / 3e-72 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1) AT2G14620 212 / 2e-68 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1) AT5G57560 210 / 4e-68 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT3G23730 210 / 6e-68 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G57550 207 / 6e-67 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G021000 [exp] 407 / 1e-145 AT1G11545 498 / 3e-180 xyloglucan endotransglucosylase/hydrolase 8 (.1) Potri.014G152700 [exp] 383 / 9e-137 AT1G11545 365 / 3e-128 xyloglucan endotransglucosylase/hydrolase 8 (.1) Potri.019G125000 [exp] 234 / 4e-77 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.014G140300 [exp] 231 / 6e-76 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.001G071000 [exp] 230 / 1e-75 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.013G152400 [exp] 228 / 6e-75 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.003G159700 [exp] 228 / 9e-75 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.007G008500 [exp] 224 / 3e-73 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1) Potri.005G201200 [exp] 223 / 5e-73 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007645 [exp] 380 / 4e-135 AT1G11545 496 / 2e-179 xyloglucan endotransglucosylase/hydrolase 8 (.1) Lus10018365 [exp] 384 / 2e-133 AT1G11545 510 / 0.0 xyloglucan endotransglucosylase/hydrolase 8 (.1) Lus10039715 [exp] 238 / 2e-78 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10011052 [exp] 234 / 1e-76 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10003022 [exp] 233 / 1e-76 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10018503 [exp] 230 / 2e-75 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10040121 [exp] 228 / 9e-75 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10030923 [exp] 228 / 1e-74 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10031586 [exp] 225 / 1e-73 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10011597 [exp] 217 / 2e-70 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.011G025800.2 pacid=42780648 polypeptide=Potri.011G025800.2.p locus=Potri.011G025800 ID=Potri.011G025800.2.v4.1 annot-version=v4.1 ATGAAGCTGAAATTGGTTGGAGGTGACTCTGCAGGTGTTGTGACAGCTTATTATATGTGTACAGAGAATGGGGCAGGGCCAACAAGAGATGAGTTGGACT TTGAGTTCTTGGGGAATAGAACTGGAGAACCCTATTTGATACAAACAAATATATACAAGAATGGTACTGGTAACCGTGAAATGAGGCACATGCTTTGGTT CGACCCTACCGAGGAGTTCCACACCTATTCCATTCTCTGGAACAATCTCCAGATAGTGTTTTTTGTTGATAAAGTGGCAATAAGGGTGCACAAGAACAAT GGAGAACCAAATAATTTCTTCCCCAATGAGAAGCCCATGTACCTATTTTCAAGTATCTGGAACGCAGATGATTGGGCTACTAGAGGAGGGCTAGAGAAGA CAGACTGGAAAAAGGCCCCATTTGTGTCCTCTTACAAGGACTTCACTGTTGAAGCTTGTCAATGGGAAGATCCATACCCTGCCTGTGTATCAACAACGAC TAAATACTGGTGGGATCAATACGATGCTTGGCATCTCTCAGATGAACAGAAAATGGACTATGCCTGGGTCCAAAGAAACCTTGTGATCTATGATTATTGC AAAGACACTGAAAGATTCCCAGCACTGCCAGTGGAGTGCAAATTGAGCCCATGGGATTGA
AA sequence Show only first row Show all	>Potri.011G025800.2 pacid=42780648 polypeptide=Potri.011G025800.2.p locus=Potri.011G025800 ID=Potri.011G025800.2.v4.1 annot-version=v4.1 MKLKLVGGDSAGVVTAYYMCTENGAGPTRDELDFEFLGNRTGEPYLIQTNIYKNGTGNREMRHMLWFDPTEEFHTYSILWNNLQIVFFVDKVAIRVHKNN GEPNNFFPNEKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVSSYKDFTVEACQWEDPYPACVSTTTKYWWDQYDAWHLSDEQKMDYAWVQRNLVIYDYC KDTERFPALPVECKLSPWD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Potri.011G025800 [exp]	0	1
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Potri.014G152700 [exp]	1.00	0.9293
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.009G048200 [exp]	8.94	0.8326
					Potri.010G210600 [exp]	12.72	0.8175
AT5G03860		MLS	malate synthase (.1.2)		Potri.012G094532 [exp]	27.14	0.8039
AT3G11980		FAR2, MS2	MALE STERILITY 2, FATTY ACID R...		Potri.016G031600 [exp]	31.24	0.8082
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Potri.013G161800 [exp]	32.17	0.8066	Pt-KAO2.1,CYP88A8
AT1G42430			unknown protein		Potri.002G011300 [exp]	37.30	0.7765
AT3G09110			Protein of unknown function (D...		Potri.010G210500 [exp]	39.19	0.8034
AT1G13790		FDM4	factor of DNA methylation 4, X...		Potri.001G240666 [exp]	39.37	0.7034
AT4G27190			NB-ARC domain-containing disea...		Potri.001G420000 [exp]	51.24	0.8016

Compare expression of checked genes

Potri.011G025800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.