Potri.011G025900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45860 43 / 2e-05 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
AT5G45870 41 / 8e-05 RCAR6, PYL12 regulatory components of ABA receptor 6, PYR1-like 12 (.1)
AT1G70890 41 / 0.0001 MLP43 MLP-like protein 43 (.1)
AT2G26040 40 / 0.0002 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
AT5G05440 39 / 0.0008 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G38310 39 / 0.0008 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G025966 324 / 1e-115 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G026100 322 / 9e-115 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Potri.011G026200 316 / 1e-112 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2)
Potri.014G152800 314 / 9e-112 AT1G24020 54 / 1e-09 MLP-like protein 423 (.1.2)
Potri.011G026032 313 / 1e-111 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.004G021100 310 / 4e-110 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.016G046500 298 / 2e-105 AT1G24020 50 / 4e-08 MLP-like protein 423 (.1.2)
Potri.008G213100 275 / 6e-96 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2)
Potri.008G212500 258 / 1e-89 AT1G24020 52 / 6e-09 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016840 131 / 2e-39 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10037715 125 / 8e-37 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10003187 117 / 3e-34 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Lus10014508 92 / 4e-24 ND /
Lus10032178 90 / 3e-23 ND /
Lus10016839 80 / 3e-19 ND /
Lus10005608 79 / 7e-19 ND /
Lus10010699 47 / 2e-07 AT1G24020 56 / 7e-11 MLP-like protein 423 (.1.2)
Lus10010698 49 / 3e-07 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2)
Lus10029184 49 / 5e-07 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.011G025900.1 pacid=42781039 polypeptide=Potri.011G025900.1.p locus=Potri.011G025900 ID=Potri.011G025900.1.v4.1 annot-version=v4.1
ATGGGTGTCATCACTTTGGAAAATGAGTTTGCTGTTGCTGTCGCCCCAGCCAAGCTTTTCAAGGCATACTGCCTTGAGACCGACACTCTTTTGCCTAAAA
TTCTACCAGAGCACATTAAGAGCTGTGAGATAATTGAAGGAAATGGAGGGCCTGGAACCATCAGGAAGATCACTTTCGCTGAAGGAAAAGATCTCAGTTA
TGCCAAGCAGAAGATTGAGGCAATTGACGAAGAGAACTTGACCTACAGCTTCAGCTTGATTGAAGCCAATGTTTGGAAGGATGCAGTTGAAAAGGTGACT
TACGAGCACAAGTTCGTGCCAACTCCTGAGGGAGGTTCCATTTGCAAGAGAACCAGCACATACTACATCAAGGGTGATGCTGAGATCAACAAAGATCAAA
TCAAGGATGTGTATGGCAAAAAGACAGCAGGCTTGTTCAAGGCTGTTGAAGCCTACTTCTTAGCCAATCCAGATGCCTAA
AA sequence
>Potri.011G025900.1 pacid=42781039 polypeptide=Potri.011G025900.1.p locus=Potri.011G025900 ID=Potri.011G025900.1.v4.1 annot-version=v4.1
MGVITLENEFAVAVAPAKLFKAYCLETDTLLPKILPEHIKSCEIIEGNGGPGTIRKITFAEGKDLSYAKQKIEAIDEENLTYSFSLIEANVWKDAVEKVT
YEHKFVPTPEGGSICKRTSTYYIKGDAEINKDQIKDVYGKKTAGLFKAVEAYFLANPDA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025900 0 1
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026100 1.41 0.9920
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025966 2.00 0.9915
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026032 2.44 0.9807
AT5G56970 ATCKX3, CKX3 cytokinin oxidase 3 (.1) Potri.007G066100 2.82 0.9799
AT2G43870 Pectin lyase-like superfamily ... Potri.007G144100 4.47 0.9685
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026200 5.47 0.9602
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Potri.004G167000 7.07 0.9407
AT5G37800 bHLH ATRSL1, bHLH086 ARABIDOPSIS THALIANA RHD SIX-L... Potri.017G126800 7.48 0.9560
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.005G223300 7.48 0.9467
AT4G25250 Plant invertase/pectin methyle... Potri.015G128900 10.81 0.9252

Potri.011G025900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.