Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45860 43 / 2e-05 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1) AT5G45870 41 / 8e-05 RCAR6, PYL12 regulatory components of ABA receptor 6, PYR1-like 12 (.1) AT1G70890 41 / 0.0001 MLP43 MLP-like protein 43 (.1) AT2G26040 40 / 0.0002 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT5G05440 39 / 0.0008 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G38310 39 / 0.0008 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G025900 [exp] 324 / 1e-115 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G026100 [exp] 322 / 9e-115 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Potri.011G026200 [exp] 316 / 1e-112 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2) Potri.014G152800 [exp] 314 / 9e-112 AT1G24020 54 / 1e-09 MLP-like protein 423 (.1.2) Potri.011G026032 [exp] 313 / 1e-111 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2) Potri.004G021100 [exp] 310 / 4e-110 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2) Potri.016G046500 [exp] 298 / 2e-105 AT1G24020 50 / 4e-08 MLP-like protein 423 (.1.2) Potri.008G213100 [exp] 275 / 6e-96 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2) Potri.008G212500 [exp] 258 / 1e-89 AT1G24020 52 / 6e-09 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016840 [exp] 131 / 2e-39 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2) Lus10037715 [exp] 125 / 8e-37 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Lus10003187 [exp] 117 / 3e-34 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1) Lus10014508 [exp] 92 / 4e-24 ND / Lus10032178 [exp] 90 / 3e-23 ND / Lus10016839 [exp] 80 / 3e-19 ND / Lus10005608 [exp] 79 / 7e-19 ND / Lus10010699 [exp] 47 / 2e-07 AT1G24020 56 / 7e-11 MLP-like protein 423 (.1.2) Lus10010698 [exp] 49 / 3e-07 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2) Lus10029184 [exp] 49 / 5e-07 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.011G025966.1 pacid=42781306 polypeptide=Potri.011G025966.1.p locus=Potri.011G025966 ID=Potri.011G025966.1.v4.1 annot-version=v4.1 ATGGGCGTCATCACTTTGGAAAATGAGTTTGCTGTTGCTGTCGCCCCAGCCAAGCTTTTCAAGGCATACTGCCTTGAGACCGACACTCTTTTGCCTAAAA TTCTACCAGAGCACATTAAGAGCTGTGAGATAATTGAAGGAAATGGAGGGCCTGGAACCATCAGGAAGATCACTTTCGCTGAAGGAAAAGATCTCAGTTA TGCCAAGCAGAAGATTGAGGCAATTGACGAGGAGAACTTGACCTACAGCTTCAGCTTGATTGAAGCCAATGTTTGGAAGGATGCAGTTGAAAAGGTGACT TACGAGCACAAGTTCGTGCCAACTCCTGAGGGAGGTTCCATTTGCAAGAGAACCAGCACATACTACATCAAGGGTGATGCTGAGATCAACAAAGACCAAA TCAAGGATGTGTATGGAAAAAAGACAGCAGGCTTGTTCAAGGCTGTTGAGGCCTACTTCTTGGCCAATCCAGATGCCTAA
AA sequence Show only first row Show all	>Potri.011G025966.1 pacid=42781306 polypeptide=Potri.011G025966.1.p locus=Potri.011G025966 ID=Potri.011G025966.1.v4.1 annot-version=v4.1 MGVITLENEFAVAVAPAKLFKAYCLETDTLLPKILPEHIKSCEIIEGNGGPGTIRKITFAEGKDLSYAKQKIEAIDEENLTYSFSLIEANVWKDAVEKVT YEHKFVPTPEGGSICKRTSTYYIKGDAEINKDQIKDVYGKKTAGLFKAVEAYFLANPDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G025966 [exp]	0	1
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G026100 [exp]	1.00	0.9971
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G025900 [exp]	2.00	0.9915
AT2G43870			Pectin lyase-like superfamily ...		Potri.007G144100 [exp]	2.23	0.9745
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G026032 [exp]	3.00	0.9800
AT5G56970		ATCKX3, CKX3	cytokinin oxidase 3 (.1)		Potri.007G066100 [exp]	4.00	0.9761
AT3G61430		ATPIP1, PIP1;1,...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.004G167000 [exp]	4.00	0.9508
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G026200 [exp]	4.24	0.9691
AT5G37800	bHLH	ATRSL1, bHLH086	ARABIDOPSIS THALIANA RHD SIX-L...		Potri.017G126800 [exp]	5.91	0.9585
AT2G29060	GRAS		GRAS family transcription fact...		Potri.009G033100 [exp]	6.16	0.9184
AT3G19430			late embryogenesis abundant pr...		Potri.009G097400 [exp]	6.48	0.9053

Compare expression of checked genes

Potri.011G025966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.