Potri.011G026200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45860 39 / 0.0004 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G026100 318 / 2e-113 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Potri.011G025966 316 / 1e-112 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G025900 316 / 1e-112 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2)
Potri.011G026032 315 / 3e-112 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.014G152800 311 / 8e-111 AT1G24020 54 / 1e-09 MLP-like protein 423 (.1.2)
Potri.004G021100 308 / 2e-109 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Potri.016G046500 299 / 7e-106 AT1G24020 50 / 4e-08 MLP-like protein 423 (.1.2)
Potri.008G213100 272 / 7e-95 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2)
Potri.008G212500 259 / 3e-90 AT1G24020 52 / 6e-09 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016840 127 / 4e-38 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10037715 121 / 2e-35 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10003187 116 / 1e-33 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Lus10014508 91 / 1e-23 ND /
Lus10032178 89 / 9e-23 ND /
Lus10016839 79 / 7e-19 ND /
Lus10005608 77 / 4e-18 ND /
Lus10010698 47 / 2e-06 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2)
Lus10029184 46 / 3e-06 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2)
Lus10010699 44 / 3e-06 AT1G24020 56 / 7e-11 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.011G026200.1 pacid=42781325 polypeptide=Potri.011G026200.1.p locus=Potri.011G026200 ID=Potri.011G026200.1.v4.1 annot-version=v4.1
ATGGGTGTCATCACTTTGGAAAATGAGTTTGCTGTTGCTGTCGCTCCAGCCAAGCTTTTCAAGGCATACTGCCTTGAAATTGACACTCTTTTGCCTAAAA
TACTACCAGAGCACATTAAGAGCTCTGAGATAATTGAAGGAAATGGAGGGCCTGGAACCATCAGGAAGATCACTTTTGCTGAAGGAAAAGATCTCAGTTA
TGCCAAGCAGAAGATTGAGGCAATTGACGAAGAGAACTTGACCTACAGCTTTAGCTTGATTGAAGCCAATGTTTGGAAGGATGCAGTTGAAAAGGTGACT
TACGAGCACAAGTTCGTGCCAACCCCTGAGGGAGGATCCATTTGCAAGAGAACCAGCACATACTACATCAAGGGTGATGCTGAGATCAAGAAAGATCAAA
TCAAGGATGTATATGGAAAAAAGACAGCGGGCTTGTTCAAGGCTGTTGAAGCCTACTTCTTGGCCAATCCAGATGCCTAA
AA sequence
>Potri.011G026200.1 pacid=42781325 polypeptide=Potri.011G026200.1.p locus=Potri.011G026200 ID=Potri.011G026200.1.v4.1 annot-version=v4.1
MGVITLENEFAVAVAPAKLFKAYCLEIDTLLPKILPEHIKSSEIIEGNGGPGTIRKITFAEGKDLSYAKQKIEAIDEENLTYSFSLIEANVWKDAVEKVT
YEHKFVPTPEGGSICKRTSTYYIKGDAEIKKDQIKDVYGKKTAGLFKAVEAYFLANPDA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026200 0 1
AT2G45750 S-adenosyl-L-methionine-depend... Potri.015G139000 1.00 0.9793
AT2G29060 GRAS GRAS family transcription fact... Potri.009G033100 3.46 0.9395
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026100 3.46 0.9693
AT5G37800 bHLH ATRSL1, bHLH086 ARABIDOPSIS THALIANA RHD SIX-L... Potri.017G126800 3.46 0.9601
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025966 4.24 0.9691
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G026032 4.47 0.9672
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Potri.001G227200 4.58 0.9560
AT4G25250 Plant invertase/pectin methyle... Potri.015G128900 4.89 0.9532
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.011G025900 5.47 0.9602
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G022000 6.00 0.9516

Potri.011G026200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.