Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05220 264 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G61760 251 / 5e-85 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G44220 91 / 3e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20600 90 / 7e-22 NDR1 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01410 84 / 8e-20 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22870 79 / 4e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22200 78 / 2e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 77 / 3e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20590 76 / 1e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 75 / 2e-16 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G023300 [exp] 358 / 2e-127 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 91 / 2e-22 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 89 / 9e-22 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 79 / 9e-18 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G019600 [exp] 78 / 2e-17 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 76 / 2e-16 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G006000 [exp] 71 / 8e-15 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G158900 [exp] 71 / 2e-14 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.011G133900 [exp] 69 / 4e-14 AT3G20600 152 / 2e-46 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006754 [exp] 273 / 1e-93 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020066 [exp] 272 / 6e-93 AT4G05220 261 / 6e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018376 [exp] 151 / 7e-46 AT4G05220 152 / 3e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006755 [exp] 138 / 9e-41 AT4G05220 145 / 9e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020065 [exp] 135 / 1e-39 AT4G05220 135 / 1e-39 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 92 / 8e-23 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007636 [exp] 89 / 5e-22 AT4G05220 97 / 2e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 86 / 3e-20 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 84 / 1e-19 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10000157 [exp] 83 / 2e-19 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.011G027400.2 pacid=42780915 polypeptide=Potri.011G027400.2.p locus=Potri.011G027400 ID=Potri.011G027400.2.v4.1 annot-version=v4.1 ATGTCCACCTCCCAACAGTTACCCACTCACCATCAACGGGAACCCAAACCCATCAAACGCCACCATTCCGCCAGCTACTATGTTAATCGAGTCCGCGACA GCCTTACTACTCGGATCTCCAAGATTATATGTGGCATATTTTTAACCCTTCTATTCGTTGGTGGTATTGCTGTATTCATAACATGGCTCAGTTTACGCCC ACATCGTCCTCGGATCCTTATCTCGAATTTTTTTATTCCGGGTTTGGATCAACCTGATGGGTTCGAAAATGCTGAGATAAGTTTCAATGTCACAGCCCGG AACGCAAACCGAGCAGTTGGGTATTATTATGATTCGGTGGAAGCCTTTGTTTACTATAGAGATCGAGCAATTGGGTCTACACCCTTAGTGGACTCATTTT ACCAAGAGCCCAAAAACACAACTAATTTGTCCAAGGTGTTGAAAGGGGCCACCCTGGATGTGAATAGTGACCGTTGGCGGGTATTTAGGAAAGATTTTGC GCGTGGAGCGGTTGTTTTTCGATTAGATGTAACGGCCATGATTCGATTTAAGCTGTCCACGTGGGATAGTAAGCGCCATCGGATGCATGCCAATTGTGAT GTTGCTGTTGGCCGAGATGGGTCCATCTTGGCAACTTCTAAAAATAAGAGATGCCTTGTATATTTCACTTGA
AA sequence Show only first row Show all	>Potri.011G027400.2 pacid=42780915 polypeptide=Potri.011G027400.2.p locus=Potri.011G027400 ID=Potri.011G027400.2.v4.1 annot-version=v4.1 MSTSQQLPTHHQREPKPIKRHHSASYYVNRVRDSLTTRISKIICGIFLTLLFVGGIAVFITWLSLRPHRPRILISNFFIPGLDQPDGFENAEISFNVTAR NANRAVGYYYDSVEAFVYYRDRAIGSTPLVDSFYQEPKNTTNLSKVLKGATLDVNSDRWRVFRKDFARGAVVFRLDVTAMIRFKLSTWDSKRHRMHANCD VAVGRDGSILATSKNKRCLVYFT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G05220			Late embryogenesis abundant (L...		Potri.011G027400 [exp]	0	1
AT5G58300			Leucine-rich repeat protein ki...		Potri.016G139200 [exp]	2.23	0.9495
AT3G50870	GATA	GATA18, HAN, MN...	MONOPOLE, HANABA TANARU, GATA ...		Potri.007G024500 [exp]	4.12	0.9286	Pt-MNP.1
AT5G20870			O-Glycosyl hydrolases family 1...		Potri.006G216700 [exp]	4.24	0.9529
AT1G79480			Carbohydrate-binding X8 domain...		Potri.008G082900 [exp]	4.47	0.9515
					Potri.001G444350 [exp]	4.89	0.9458
AT3G18260			Reticulon family protein (.1)		Potri.015G044300 [exp]	5.91	0.9473
AT2G37590	DOF	AtDof2. 4, ATDO...	DNA binding with one finger 2....		Potri.006G084200 [exp]	8.00	0.9320	Pt-DOF2.3
AT1G47271			Cystathionine beta-synthase (C...		Potri.005G228300 [exp]	9.16	0.9520
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	9.59	0.9523
					Potri.004G221400 [exp]	9.94	0.9441

Compare expression of checked genes

Potri.011G027400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.