Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23160 100 / 4e-26 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23140 99 / 1e-25 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23230 94 / 3e-24 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT4G23150 92 / 2e-23 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23180 91 / 6e-23 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G05200 88 / 6e-22 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G04490 86 / 2e-21 CRK36 cysteine-rich RLK (RECEPTOR-like protein kinase) 36 (.1) AT4G38830 86 / 2e-21 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) AT4G23130 85 / 8e-21 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G11480 85 / 8e-21 CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G028700 [exp] 137 / 3e-39 AT4G21410 460 / 4e-152 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G026350 [exp] 93 / 1e-23 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.010G069800 [exp] 92 / 2e-23 AT4G21410 514 / 4e-175 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G024500 [exp] 91 / 5e-23 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024800 [exp] 91 / 7e-23 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025800 [exp] 90 / 8e-23 AT4G23180 648 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G029700 [exp] 90 / 8e-23 AT4G21410 578 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G030000 [exp] 90 / 9e-23 AT4G21410 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G029000 [exp] 90 / 1e-22 AT4G21410 537 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018379 [exp] 92 / 4e-23 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007632 [exp] 89 / 2e-22 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018382 [exp] 89 / 2e-22 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10018381 [exp] 85 / 1e-21 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007633 [exp] 86 / 4e-21 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10037865 [exp] 85 / 6e-21 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10034971 [exp] 83 / 7e-21 AT4G23180 269 / 5e-86 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10038557 [exp] 85 / 1e-20 AT4G27290 803 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007602 [exp] 84 / 2e-20 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10018405 [exp] 83 / 4e-20 AT4G21380 952 / 0.0 receptor kinase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.011G028901.1 pacid=42781621 polypeptide=Potri.011G028901.1.p locus=Potri.011G028901 ID=Potri.011G028901.1.v4.1 annot-version=v4.1 ATGGCAAAGCTATTTCAAATGGATCAAACGCAAGATGCCACAAGTAGAATTGTGGGGACCTTGGGCTACATGGCTCCAGAATATGCGATGCATGGATGCT TCTCAGCGAAGTCAGATGTTCTTAGCTTCGGTGAGCTAGTTGTGGAGATTATTACCGGTCGTCAAAATGGTTCATTCAATAGCGAGGAAGAACAAGAATA CCTCTCACCAACGCATGGGAGAGTTGGAATGAAGGAAGAACATTAA
AA sequence Show only first row Show all	>Potri.011G028901.1 pacid=42781621 polypeptide=Potri.011G028901.1.p locus=Potri.011G028901 ID=Potri.011G028901.1.v4.1 annot-version=v4.1 MAKLFQMDQTQDATSRIVGTLGYMAPEYAMHGCFSAKSDVLSFGELVVEIITGRQNGSFNSEEEQEYLSPTHGRVGMKEEH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028901 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.019G001314 [exp]	2.00	0.8444
					Potri.003G184501 [exp]	2.82	0.8248
AT4G12731			unknown protein		Potri.009G022366 [exp]	5.74	0.8022
AT5G36930			Disease resistance protein (TI...		Potri.019G003942 [exp]	7.21	0.8007
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Potri.011G020900 [exp]	7.48	0.7730	ACO7,Pt-ACO1.3
AT2G35615			Eukaryotic aspartyl protease f...		Potri.003G105300 [exp]	12.84	0.7532
					Potri.019G002628 [exp]	14.14	0.7941
AT4G00770			unknown protein		Potri.014G077400 [exp]	16.12	0.7147
AT5G36930			Disease resistance protein (TI...		Potri.019G000657 [exp]	17.32	0.7276
AT4G29560			unknown protein		Potri.006G151500 [exp]	18.24	0.6888

Compare expression of checked genes

Potri.011G028901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.