Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38830 189 / 9e-56 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) AT3G22060 172 / 8e-53 Receptor-like protein kinase-related family protein (.1) AT4G05200 175 / 1e-50 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G21230 173 / 7e-50 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1) AT4G21410 173 / 1e-49 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) AT4G21400 158 / 3e-44 CRK28 cysteine-rich RLK (RECEPTOR-like protein kinase) 28 (.1) AT4G23220 156 / 2e-43 CRK14 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1) AT2G31620 146 / 9e-43 Receptor-like protein kinase-related family protein (.1) AT3G21940 138 / 1e-39 Receptor protein kinase-related (.1) AT3G21990 137 / 2e-39 Domain of unknown function (DUF26) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G030400 [exp] 534 / 0 AT4G38830 190 / 4e-56 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) Potri.011G028500 [exp] 404 / 2e-143 AT4G05200 160 / 4e-44 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.011G029900 [exp] 280 / 5e-97 AT4G05200 112 / 1e-29 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G026200 [exp] 262 / 2e-83 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G025425 [exp] 261 / 3e-83 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G030300 [exp] 237 / 8e-74 AT4G21410 533 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G028600 [exp] 236 / 2e-73 AT4G21410 554 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G026350 [exp] 232 / 7e-72 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G029300 [exp] 229 / 6e-71 AT4G21410 539 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018382 [exp] 196 / 4e-58 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10018380 [exp] 187 / 6e-57 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007632 [exp] 173 / 2e-49 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10026629 [exp] 166 / 5e-47 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10018377 [exp] 159 / 2e-44 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007634 [exp] 144 / 3e-39 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10027145 [exp] 135 / 1e-38 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1) Lus10018379 [exp] 142 / 2e-38 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10031581 [exp] 134 / 8e-36 AT4G23310 213 / 2e-60 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10038227 [exp] 124 / 4e-34 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.011G029400.1 pacid=42781052 polypeptide=Potri.011G029400.1.p locus=Potri.011G029400 ID=Potri.011G029400.1.v4.1 annot-version=v4.1 ATGGCAATGTTACCATCAAAATTGCTCTTCTTTTTTAGTCCTGTTTTCATTCACCTCCTCGTTCTCACTATGGCACAAACAAATCTGCTTCAGCACTTTT GTATAGAAAATCATGGTAACTTCAGTGCTAATAGTGACTACAAATCAAACCTCGATCGCCTTATCTCCTCCTTCTCTTCTGATACAAATAATGATTATGG GTTTTACACTGGCTCCTTTGGCGAAAACATCGACAAAGCTTATGCAATTTCGCTTTGTAGAGGAGATAAAAAGCCTGAAACCTGCCGTAGTTGCATTAAA AATTCCAGCCAAGTGCTCTCACAACTTTGTCCGAACCAAAAGGAGGCCTATATTTGGTATGATGATTGTATGTTGAGGTATGCAAACCATACCATTTTTA ACAGTATGGAATTCGGTCCGTACTTTTGGATGTACAGCCTGGTTAATGTTACCGACGAAAATGAGTTCAATGAGGTGCTAAATGCCTTGTTAGGCAGACT GATAAATTTTGCAGCGTTAGGTGATTCACGAAGAAAATTTGCAGCAGGAAATGCGACAGCAGAAAAGTCTCAACAAACAATGTATGCACTTGTTCAGTGC ACTCCTGATTTGACTCAGCAGCAATGCAGCGATTGCCTGAATCAAGCTATCAAATTGATTCCAACATGCTGTTCTAAGAGGCAAGGAGGGAGGGTGGTTT CACCTAGCTGTCACTTTCGATACGAAAAGGACCCTTTCTATGACCTTGCAAGCACTTCGCCACTGCCACCATAG
AA sequence Show only first row Show all	>Potri.011G029400.1 pacid=42781052 polypeptide=Potri.011G029400.1.p locus=Potri.011G029400 ID=Potri.011G029400.1.v4.1 annot-version=v4.1 MAMLPSKLLFFFSPVFIHLLVLTMAQTNLLQHFCIENHGNFSANSDYKSNLDRLISSFSSDTNNDYGFYTGSFGENIDKAYAISLCRGDKKPETCRSCIK NSSQVLSQLCPNQKEAYIWYDDCMLRYANHTIFNSMEFGPYFWMYSLVNVTDENEFNEVLNALLGRLINFAALGDSRRKFAAGNATAEKSQQTMYALVQC TPDLTQQQCSDCLNQAIKLIPTCCSKRQGGRVVSPSCHFRYEKDPFYDLASTSPLPP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G38830		CRK26	cysteine-rich RLK (RECEPTOR-li...		Potri.011G029400 [exp]	0	1
AT4G38830		CRK26	cysteine-rich RLK (RECEPTOR-li...		Potri.011G030400 [exp]	1.00	0.9600
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Potri.019G094100 [exp]	2.44	0.8965
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Potri.014G041900 [exp]	6.00	0.8903
AT1G24140			Matrixin family protein (.1)		Potri.013G033200 [exp]	11.48	0.8691
AT4G35070			SBP (S-ribonuclease binding pr...		Potri.002G019000 [exp]	13.00	0.8539
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G029900 [exp]	16.70	0.8622
AT1G78850			D-mannose binding lectin prote...		Potri.011G110500 [exp]	20.73	0.8998
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Potri.004G185000 [exp]	27.49	0.8235
AT1G65620	AS2	AS2	ASYMMETRIC LEAVES 2, Lateral o...		Potri.010G177100 [exp]	27.92	0.8483	AS2.1
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.014G020432 [exp]	27.96	0.8268

Compare expression of checked genes

Potri.011G029400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.