Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11530 93 / 1e-25 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT3G56420 59 / 5e-12 Thioredoxin superfamily protein (.1) AT3G51030 57 / 1e-11 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT2G40790 56 / 9e-11 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G08710 52 / 3e-09 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT5G42980 50 / 6e-09 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT2G35010 52 / 7e-09 ATO1 thioredoxin O1 (.1.2) AT1G59730 47 / 1e-07 ATH7 thioredoxin H-type 7 (.1) AT1G31020 47 / 2e-07 ATO2 thioredoxin O2 (.1) AT1G45145 46 / 4e-07 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G031700 [exp] 119 / 1e-35 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 101 / 7e-29 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 55 / 2e-10 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 54 / 5e-10 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 54 / 1e-09 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.005G232700 [exp] 52 / 1e-09 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.016G138800 [exp] 50 / 1e-08 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.002G030000 [exp] 47 / 1e-07 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.001G159000 [exp] 48 / 2e-07 AT2G35010 162 / 7e-51 thioredoxin O1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018383 [exp] 85 / 3e-22 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10020070 [exp] 82 / 4e-21 AT1G11530 145 / 4e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10007630 [exp] 82 / 4e-21 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10022727 [exp] 57 / 4e-11 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 57 / 5e-11 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10037228 [exp] 54 / 3e-10 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10037227 [exp] 52 / 2e-09 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 50 / 2e-08 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10036695 [exp] 50 / 2e-08 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10014277 [exp] 49 / 2e-08 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.011G031100.1 pacid=42781665 polypeptide=Potri.011G031100.1.p locus=Potri.011G031100 ID=Potri.011G031100.1.v4.1 annot-version=v4.1 ATGGAAAGCGAAGCCACCAATAAGTCAAGAGTTGTAATGGTGGAGTCAGGGGAGTCTTGGGACTTCTATATCTCCCAAGCCACCACTCAAACCTGCCCTA TCGCTGTTCACTTTACTGCCTCATGGTGTATGCCATCAGTGGCCATGAACCCAATTTTTGAAGATCTGGCTTCAGCTCATCCAGATATCCTGTTTCTCAC TGTTGATGTGGATGCTGTCAAGATATTTGTTAGTGCTATCTTTACAAAGATACGACTTCAAATATTTGGTGATTTGATTCCTTCACATGAGGCTGGGAAT GAGCACCGTGTGGTTTCTAGTGGAAACTTTATTCTTATTGTGATTGATATGAAAGATCATCACTAA
AA sequence Show only first row Show all	>Potri.011G031100.1 pacid=42781665 polypeptide=Potri.011G031100.1.p locus=Potri.011G031100 ID=Potri.011G031100.1.v4.1 annot-version=v4.1 MESEATNKSRVVMVESGESWDFYISQATTQTCPIAVHFTASWCMPSVAMNPIFEDLASAHPDILFLTVDVDAVKIFVSAIFTKIRLQIFGDLIPSHEAGN EHRVVSSGNFILIVIDMKDHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Potri.011G031100 [exp]	0	1
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Potri.008G183000 [exp]	23.57	0.8747
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Potri.008G186300 [exp]	31.24	0.8212	ERF61
AT3G50160			Plant protein of unknown funct...		Potri.016G039100 [exp]	50.08	0.8565
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Potri.004G207900 [exp]	98.51	0.8415	RFS.2
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Potri.015G106900 [exp]	159.08	0.8233	Pt-LEAFY.1
					Potri.003G004301 [exp]	161.80	0.8070

Compare expression of checked genes

Potri.011G031100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.