Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11340 171 / 7e-49 S-locus lectin protein kinase family protein (.1) AT1G11410 162 / 5e-46 S-locus lectin protein kinase family protein (.1) AT4G21380 137 / 5e-37 ARK3 receptor kinase 3 (.1) AT4G27290 125 / 5e-33 S-locus lectin protein kinase family protein (.1) AT1G65790 107 / 7e-27 ARK1 receptor kinase 1 (.1) AT1G65800 106 / 3e-26 ARK2 receptor kinase 2 (.1) AT4G27300 100 / 2e-24 S-locus lectin protein kinase family protein (.1) AT3G12000 95 / 1e-22 S-locus related protein SLR1, putative (S1) (.1) AT2G19130 95 / 2e-22 S-locus lectin protein kinase family protein (.1) AT4G21390 87 / 1e-19 B120 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G036400 [exp] 394 / 2e-133 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 359 / 6e-120 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 358 / 3e-119 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 345 / 2e-114 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036532 [exp] 267 / 4e-90 AT1G11340 247 / 6e-75 S-locus lectin protein kinase family protein (.1) Potri.011G035700 [exp] 266 / 3e-84 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028300 [exp] 252 / 4e-79 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 179 / 1e-51 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028466 [exp] 175 / 2e-50 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024064 [exp] 233 / 2e-71 AT1G11340 735 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10041680 [exp] 223 / 8e-67 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10007604 [exp] 218 / 4e-66 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10005136 [exp] 202 / 2e-61 AT1G11340 471 / 2e-155 S-locus lectin protein kinase family protein (.1) Lus10013910 [exp] 201 / 6e-60 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018402 [exp] 197 / 2e-58 AT1G11340 691 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10024063 [exp] 197 / 6e-58 AT1G15520 1623 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10013244 [exp] 195 / 8e-58 AT1G11340 669 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013246 [exp] 195 / 9e-58 AT1G11340 678 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030767 [exp] 193 / 2e-56 AT1G11340 670 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00954 [poplar] [flax] S_locus_glycop S-locus glycoprotein domain CL0168 [poplar] [flax] PAN PF08276 [poplar] [flax] PAN_2 PAN-like domain
Representative CDS sequence Show only first row Show all	>Potri.011G035901.1 pacid=42781188 polypeptide=Potri.011G035901.1.p locus=Potri.011G035901 ID=Potri.011G035901.1.v4.1 annot-version=v4.1 ATGAAACTGGTGCTGGATCGAAAATTAGGAATTGATCGGTTCCTAACATCATGGAGATCAGCTGAAGACCCTGGGTTCAGGGACTTTTCAGTTAGGATCA ACCCAAATGGCTCGCCACAATTCTTTTTCTATAATGGTAAAAAGCCAATTAGTAGATCTCCCCCTTGGCCATGGAGAAGTCAGATGGGCTTATACAAAAG CACTTTTGTAAATGATCCAGATGAAATATACTGGGTCTACACAGTTCCTGATGATTCTTATCTGCTAAGAATAATAGTAGATCATTCAGGACTTCTAAAG GTGTTAACATGGCGAGAAAGTGATGGTCAGTGGAAGGATTACTGGAAGGCCCCAGTGTTTCAGTGCGACTATTATGGACTGTGTGGTGCTTATAGTACGT GTGAACTTGCCAATCATAATAGATTTGAATGTGCCTGTTTACCTGGGTTCGAGCCCAAGTACCCATTGGAATGGTCTACGAGAGATGGGTCCGATGGTTG TGTCAGGAAGCGGCTACAGACGTCTTCGTTGTGCCAGCATGGAGAAGGGTTTGTGAAGGTAGAAAATGTAATTCTTCCGGAAAGTTCAGATTCAGCTTGG GTAGACATGAGCAAGAGTCGTGCAGACTGTGAAGTGGAATGCAAGAGGAATTGTTCATAA
AA sequence Show only first row Show all	>Potri.011G035901.1 pacid=42781188 polypeptide=Potri.011G035901.1.p locus=Potri.011G035901 ID=Potri.011G035901.1.v4.1 annot-version=v4.1 MKLVLDRKLGIDRFLTSWRSAEDPGFRDFSVRINPNGSPQFFFYNGKKPISRSPPWPWRSQMGLYKSTFVNDPDEIYWVYTVPDDSYLLRIIVDHSGLLK VLTWRESDGQWKDYWKAPVFQCDYYGLCGAYSTCELANHNRFECACLPGFEPKYPLEWSTRDGSDGCVRKRLQTSSLCQHGEGFVKVENVILPESSDSAW VDMSKSRADCEVECKRNCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11340			S-locus lectin protein kinase ...		Potri.011G035901 [exp]	0	1
AT5G49760			Leucine-rich repeat protein ki...		Potri.004G231200 [exp]	1.00	0.9408
AT5G51070		SAG15, CLPD, ER...	SENESCENCE ASSOCIATED GENE 15,...		Potri.012G112000 [exp]	2.44	0.9303	Pt-ERD1.4
AT1G11340			S-locus lectin protein kinase ...		Potri.011G036100 [exp]	4.00	0.9076
AT1G11340			S-locus lectin protein kinase ...		Potri.011G036400 [exp]	5.91	0.9125
AT4G38460		GGR	geranylgeranyl reductase (.1)		Potri.009G139600 [exp]	6.24	0.9254
AT5G03430			phosphoadenosine phosphosulfat...		Potri.006G123000 [exp]	11.40	0.9186
AT1G11340			S-locus lectin protein kinase ...		Potri.011G035800 [exp]	12.00	0.9048
AT5G49900			Beta-glucosidase, GBA2 type fa...		Potri.003G003400 [exp]	12.48	0.9202
AT3G05970		LACS6, ATLACS6	long-chain acyl-CoA synthetase...		Potri.010G090200 [exp]	16.88	0.8943	Pt-LACS6.1
AT1G66920			Protein kinase superfamily pro...		Potri.017G117065 [exp]	17.49	0.9134

Compare expression of checked genes

Potri.011G035901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.