Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11410 56 / 5e-10 S-locus lectin protein kinase family protein (.1) AT4G27290 56 / 5e-10 S-locus lectin protein kinase family protein (.1) AT1G11300 56 / 5e-10 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G11340 50 / 4e-08 S-locus lectin protein kinase family protein (.1) AT4G21390 48 / 2e-07 B120 S-locus lectin protein kinase family protein (.1) AT1G11350 40 / 9e-05 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT1G61550 39 / 0.0002 S-locus lectin protein kinase family protein (.1) AT4G21380 39 / 0.0003 ARK3 receptor kinase 3 (.1) AT1G11330 39 / 0.0004 S-locus lectin protein kinase family protein (.1.2) AT1G11280 38 / 0.0005 S-locus lectin protein kinase family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G036532 [exp] 138 / 2e-41 AT1G11340 247 / 6e-75 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 135 / 3e-38 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 133 / 2e-37 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036400 [exp] 129 / 7e-36 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 126 / 4e-35 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035700 [exp] 107 / 2e-28 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028300 [exp] 96 / 3e-24 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125301 [exp] 62 / 2e-12 AT4G27290 775 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 61 / 6e-12 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005052 [exp] 73 / 8e-17 AT4G27290 87 / 3e-19 S-locus lectin protein kinase family protein (.1) Lus10013910 [exp] 72 / 7e-16 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030768 [exp] 72 / 7e-16 AT1G11340 667 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030765 [exp] 69 / 2e-15 AT1G11340 88 / 1e-20 S-locus lectin protein kinase family protein (.1) Lus10013244 [exp] 69 / 6e-15 AT1G11340 669 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013245 [exp] 69 / 7e-15 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10034637 [exp] 68 / 2e-14 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030766 [exp] 67 / 5e-14 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013246 [exp] 66 / 2e-13 AT1G11340 678 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10025512 [exp] 64 / 5e-13 AT1G11340 530 / 5e-177 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G035913.1 pacid=42780747 polypeptide=Potri.011G035913.1.p locus=Potri.011G035913 ID=Potri.011G035913.1.v4.1 annot-version=v4.1 ATGATTGGATCGTTCCTGTTGGCGACCCACACCACAGTTTGTTCTGGTATTTTATGGTACCAAATTCCAAGATATCTGTTGCTAGAACTACCTGGACAGA AAAATCCTAGTGCAAAATTATTTCCTTTGGAGATAAGAAGGTCACCTTCTTTAACGGTGTGGTTCGTCTTTAAGGAGTCTTGGGATGTACAAGATGATAA TTGGAGTGATTGCAGACGCATACAAAAACAACATAAAAAAGACAATAAACACAAAGAAAGATGGAATTGCGTCGAAAAAGACAAAATCATTCAAACTTTT ATACTCAAAAATTTTCTAATTAAATTTAAATATTAA
AA sequence Show only first row Show all	>Potri.011G035913.1 pacid=42780747 polypeptide=Potri.011G035913.1.p locus=Potri.011G035913 ID=Potri.011G035913.1.v4.1 annot-version=v4.1 MIGSFLLATHTTVCSGILWYQIPRYLLLELPGQKNPSAKLFPLEIRRSPSLTVWFVFKESWDVQDDNWSDCRRIQKQHKKDNKHKERWNCVEKDKIIQTF ILKNFLIKFKY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27290			S-locus lectin protein kinase ...		Potri.011G035913 [exp]	0	1
AT3G62550			Adenine nucleotide alpha hydro...		Potri.002G196700 [exp]	2.44	0.9300
AT1G11340			S-locus lectin protein kinase ...		Potri.011G035800 [exp]	2.44	0.9569
AT1G72510			Protein of unknown function (D...		Potri.006G219100 [exp]	4.89	0.9193
AT1G11340			S-locus lectin protein kinase ...		Potri.011G036400 [exp]	5.29	0.9156
AT1G26190			Phosphoribulokinase / Uridine ...		Potri.010G134400 [exp]	5.56	0.8451
AT5G18130			unknown protein		Potri.013G057200 [exp]	7.07	0.9182
AT4G01970		RS4, ATSTS	raffinose synthase 4, stachyos...		Potri.014G118400 [exp]	8.48	0.9027
AT1G11340			S-locus lectin protein kinase ...		Potri.011G036466 [exp]	8.48	0.8656
AT1G11340			S-locus lectin protein kinase ...		Potri.011G036532 [exp]	8.66	0.8778
AT3G23790		AAE16	acyl activating enzyme 16, AMP...		Potri.001G321800 [exp]	8.83	0.9167

Compare expression of checked genes

Potri.011G035913 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.