Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11350 180 / 3e-53 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT1G11330 178 / 1e-52 S-locus lectin protein kinase family protein (.1.2) AT1G11300 170 / 9e-50 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT4G23150 154 / 1e-44 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23180 150 / 4e-43 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT1G65790 150 / 7e-43 ARK1 receptor kinase 1 (.1) AT1G61610 148 / 6e-42 S-locus lectin protein kinase family protein (.1) AT1G65800 145 / 8e-41 ARK2 receptor kinase 2 (.1) AT4G23140 142 / 5e-40 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G21380 139 / 5e-39 ARK3 receptor kinase 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G038512 [exp] 305 / 2e-108 AT1G11350 215 / 1e-65 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) Potri.011G038800 [exp] 286 / 4e-93 AT1G11330 838 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G037800 [exp] 275 / 1e-88 AT1G11330 838 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038401 [exp] 268 / 2e-84 AT1G11330 826 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039200 [exp] 230 / 6e-72 AT1G11330 864 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039100 [exp] 227 / 8e-71 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038000 [exp] 223 / 2e-68 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039400 [exp] 218 / 2e-67 AT1G11330 822 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039300 [exp] 218 / 3e-67 AT1G11330 829 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023391 [exp] 160 / 5e-46 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10018405 [exp] 152 / 2e-43 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10007603 [exp] 151 / 4e-43 AT4G21380 942 / 0.0 receptor kinase 3 (.1) Lus10007602 [exp] 149 / 2e-42 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10038555 [exp] 139 / 2e-42 AT4G27300 183 / 4e-54 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 149 / 4e-42 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038411 [exp] 140 / 1e-41 AT1G11330 308 / 1e-98 S-locus lectin protein kinase family protein (.1.2) Lus10009583 [exp] 134 / 6e-41 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10007609 [exp] 132 / 4e-40 AT1G11410 142 / 5e-40 S-locus lectin protein kinase family protein (.1) Lus10039767 [exp] 141 / 2e-39 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase CL0016 [poplar] [flax] PF11883 [poplar] [flax] DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence Show only first row Show all	>Potri.011G038166.2 pacid=42781952 polypeptide=Potri.011G038166.2.p locus=Potri.011G038166 ID=Potri.011G038166.2.v4.1 annot-version=v4.1 ATGTCCCCTGAATATTTAATGAAAGGAAGATTTTCAGAGAAATCAGATGTATTTAGCTTTGGAGTGTTGTTGCTGGAGATCGTAAGCGGAAGAAAGAACT CTAGTTTTTATGACAATGAGCATTCTTTGAGTCTTATAGGATTTGCTTGGAAACTGTGGAATGAAGGTGACATTACAGCTCTGGTCGTTCCTGCAATATC AGATCCATGTTTTCAGGTTGAGATATTCCGATGCATACATATTGGTCTGTTGTGCGTGCAAGAATTGGCGAAAGACAGACCGGCCGTGTCTACCATCACT TCCATGCTAAATAGTGAAAGTGTGGATCTTCCTCCTCCAAAGAAACCAGCATTTGTTGAAAGGCAGAGTTCCTTGGATACAGAGTCCATTACACAGAACC AAGAGATAAATTCCATTAACAATGTGACGATTTCTGATGTTAACGGCCGATAG
AA sequence Show only first row Show all	>Potri.011G038166.2 pacid=42781952 polypeptide=Potri.011G038166.2.p locus=Potri.011G038166 ID=Potri.011G038166.2.v4.1 annot-version=v4.1 MSPEYLMKGRFSEKSDVFSFGVLLLEIVSGRKNSSFYDNEHSLSLIGFAWKLWNEGDITALVVPAISDPCFQVEIFRCIHIGLLCVQELAKDRPAVSTIT SMLNSESVDLPPPKKPAFVERQSSLDTESITQNQEINSINNVTISDVNGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11350		SD1-13, RKS2, C...	CALMODULIN-BINDING RECEPTOR-LI...		Potri.011G038166 [exp]	0	1
AT1G11350		SD1-13, RKS2, C...	CALMODULIN-BINDING RECEPTOR-LI...		Potri.011G038512 [exp]	1.00	0.7478
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.006G007100 [exp]	41.49	0.6673
AT1G44170		ALDH4, ALDH3H1	aldehyde dehydrogenase 4, alde...		Potri.002G081800 [exp]	169.81	0.5750	Pt-ALDH3.1
AT1G11330			S-locus lectin protein kinase ...		Potri.011G038500 [exp]	190.78	0.5887

Compare expression of checked genes

Potri.011G038166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.